office administrative software jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

office administrative software Job Openings

Showing 23901 - 23950 of 66392 Jobs

Java Full Stack Developer

Live Connections 5.00 to 10.00 Years Hyderabad 01 Apr, 2025

Formulate and define system scope and objectives for assigned projects
Develop appropriate software solutions to requests for new services and functionality
Develop...
angularawsjavamicroservices

office itor

ASSETCARE SERVICES PRIVATE LIMITED 1.00 to 5.00 Years Hyderabad,Bangalore, Chennai, Kolkata, Gurugram, Chittoor, Faridabad, Chandigarh, Delhi, Ahmedabad 01 Apr, 2025

Applications Developer

RAJPUT PROTECTION SERVICE PRIVATE LIMITED 13.00 to 23.00 Years Hyderabad,Jaipur, Bangalore, Jaisalmer, Noida, Chennai, Gurugram, Pune, Delhi, Guwahati 01 Apr, 2025

Job brief We are seeking a qualified and talented Application Developer to join our team. In this role, you will be responsible for designing and coding functional programs and applications. ...
architecture governancevalue engineeringconstruction managementdeveloper/d2kengineeringapplication architecture

AR Caller / Senior AR Caller - Denial Management

AATRAL HR CONSULTING LLP 1.00 to 6.00 Years Hyderabad,Bangalore, Pune, Mumbai City 01 Apr, 2025

Experience and Skills Required

Minimum 1 Years of experience in AR Caller (Voice)
Knowledge of Physician Billing or Hospital Billing and D...
ub04us healthcaremedical billingcms-1500ar callingar calling medical billing

Full Stack Developer

LTIMindtree Limited 6.00 to 10.00 Years Hyderabad,Noida 01 Apr, 2025

sdlc

java

aws

Debt Manager

Live Connections 3.00 to 7.00 Years Hyderabad 01 Apr, 2025

Description Job Requirements Job Title Collection Manager-BIL, Personal Loan and MBL Functio...
collections processcollection strategyrecovery managementconsumer debtcollection managementcollection systemsdebt collection

Online Data Entry Operator, Data Entry Clerk, Data Entry Typing, Data Entry
Ruppan India Nidhi Limited 0.00 to 1.00 Years Hyderabad,Bangalore, Noida, Chennai, Gurugram, Kolkata, Pune, Mumbai City, Delhi, Patna 01 Apr, 2025

Freshers and Experienced both can apply for this jobs. Position- Data Entry Executive, Computer Operator, Typist. Back Office Executive Location: Work From Hom...
online work from homedata entry typingonline data entrywork from homepart timedata entry

Part Time Computer , Back Office Executive, Typist, Typing, Online Data Entry
Ruppan India Nidhi Limited 0.00 to 1.00 Years Hyderabad,Bangalore, Noida, Chennai, Gurugram, Kolkata, Pune, Mumbai City, Delhi, Patna 01 Apr, 2025

We are offering a Job. Data Entry Operator, Computer Operator, Back Office Executive, Typist Freshers and Experienced both can apply for this jobs. Position- Data Entry Executi...
part timeback officeonline work from homedata entry typinghome based data entrywork from homedata entryonline data entrydata entryin

Automation Testing
Srijan Spectrum Pvt Ltd 8.00 to 13.00 Years Hyderabad,Bangalore, Noida, Chennai, Gurugram, Kolkata, Pune, Mumbai City, Delhi 01 Apr, 2025

Automation Engineer Exp : 9 - 15 Notice : 0 - 30 Days Location : Remote Skills : UI Automation, ETL Automation, UAT Testing Timing : 12.30 PM - 9.30 PM Must Have Lead experience ui testinguat

Hospital Manager
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 13.00 to 18.00 Years Hyderabad,Bangalore, Kochi, Chennai, Gurugram, Kolkata, Kollam, Thiruvanananthapuram, Mumbai City, D 01 Apr, 2025

We are looking for an experienced Hospital Administration Manager to run our medical facility. To be successful in this role, you should have a deep understanding of all administrative hospital ...
problemmanagementbudgetingassurancecollaborationcommunicationqualityfinancialsolving

Medical Officer
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 10.00 to 17.00 Years Hyderabad,Bangalore, Chennai, Kochi, Noida, Gurugram, Kollam, Thiruvanananthapuram, Mumbai City, Del 01 Apr, 2025

We are seeking a highly capable medical officer to manage our medical team and to supervise the healthcare services that they provide. In this role, your duties will include serving as a clinical...
patient safetydiagnosispatient carecommunication

Part Time , Data Entry , Online Typing , Home Based , Work From Home
Ruppan India Nidhi Limited 0.00 to 1.00 Years Gwalior,Jabalpur, Kurnool, Jodhpur, Vapi, Kota, Vijayawada, Thrissur, Ambala, Cuddalore 01 Apr, 2025

We are offering a Job. Part Time Jobs, Data Entry Work, Online Computer Work, Work From Home, Back Office Executive, Typist, Online Typing Jobs Freshers and Experienced both can apply for this j...
data entry typingpart timework from homeback officeonline data entrydata entrycontent writingcomputer operatingonline work from home

Requirement in Agency Development manager for Life Insurance CTc upto 5.5 lacs
ATS Infovision 3.00 to 8.00 Years Gwalior,Bhopal, Jabalpur, Solapur, Rajkot, Pune, Aurangabad, Surat, Nagpur 01 Apr, 2025

Dear Candidates, Greetings of the day! Candidate Qualifications:

Previous Sales Experience: Proven success in a sales role, prefe...
agency developmentagent recruitmentunit manager

Back Office Coordinator
Aspect Solution 0.00 to 1.00 Years Gwalior,Jhansi, Bangalore, Madurai, Chennai, Other Odisha, Nizamabad, Basti, Kohima, Tiruppur 01 Apr, 2025

We are hiring for various positions at a leading online platform dedicated to providing part-time job opportunities for freshers. skills needed:Can...
exceltypingdata entry

Operations Manager
WorkMint 0.00 to 4.00 Years Gwalior,Indore, Bhopal, Mandideep, Pithampur, Rewa, Dewas, Chhindwara, Singrauli, Balaghat 01 Apr, 2025

WorkMint Hiring For Banking Operations Manager Job Description Provide day to day planning and tracking support to field operations to ensure efficient and effective operations. 2. Del...
back office operationsbackend operationsback office management

Urgent Hiring for Field sales executive for Hyderabad, Prayagraj , Visakhap
Jobs Territory 1.00 to 4.00 Years Gwalior,Ongole, Tirupati, Hyderabad, Other Andhra Pradesh, Vijayawada, Vishakhapatnam 01 Apr, 2025

Sr. Solar Sales Specialist Roles and responsibilities: Responsible for meeting Monthly Sales targets of Solar PV systems for Residential clients. Lead Generation - Ensure that all marketing le...
solar energysalesfield sales

Civil Engineer
Divya Staffing Solution 0.00 to 4.00 Years Gwalior,Ujjain, Indore, Bhopal, Katni, Balaghat, Sagar, Jabalpur, Rewa, Kuwait, United Arab Emirates 01 Apr, 2025

Civil Engineers plan, design, manage, and construct a range of infrastructure, including roads, railways, bridges, airports, mines, buildings, dams, water systems, and several more. They analyse ...
budgetingtechnicalschedulinganalysis

Product Manager
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 15.00 to 25.00 Years Gwalior,Indore, Bhopal, Jabalpur, Ratlam, Sagar, Ernakulam, Pala, Wayanad, Thiruvananthapuram 01 Apr, 2025

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c...
product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing

Data Entry Operator
Fast Recruitment Services 1.00 to 0.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

Hello Dear applicant. Make your dreams come true with Online Form Filling Data Entry brings an online work opportunity. skill: Basic typing speed or good typing speed Job Position: Computer O...
back officedata entry

Production Engineer
Garima Interprises 1.00 to 6.00 Years Gurugram,Delhi, Noida, Australia, Austria, Canada, Other AndamanNicobar, Port Blair, Bangalore, Chen 01 Apr, 2025

Production Engineer Job Description Template We are searching for a reliable, innovative production engineer to oversee manufacturing processe...
labordiagnosisreportingdocumentationcommunicationsafetyscheduling managementmanufacturing processes

Pipeline Engineer
Garima Interprises 1.00 to 6.00 Years Gurugram,Delhi, Noida, Australia, Austria, Canada, Other AndamanNicobar, Port Blair, Bangalore, Chen 01 Apr, 2025

Pipeline Engineer Job Description Template We are looking for a highly experienced pipeline engineer to design and develop a variety of pipeline...
budgetingblueprintcommunicationrepairconstruction technologytechnical standards

Academic Counsellor
Ksirius Consultants Hiring For Aimlay and IIDE 1.00 to 4.00 Years Gurugram,Delhi, Noida, Ambernath, Thane, Mumbai City, Dombivali 01 Apr, 2025

Responsibilities: Contact prospective customers through inbound leads follow up on calls and emails (leads are provided). Converting the leads via Outbound calls Explaining the services and conve...
outbound salesacademic consultinginside salescounsellor

Cluster Head - ADRV Insurance Team Handling Profile Salary Upto 14Lac
Niyukti Management Consultants 10.00 to 17.00 Years Gurugram,Delhi, Noida, Lucknow, Pune, Mumbai City 01 Apr, 2025

We are currently hiring for a key position and would like to share the updated requirements with you. Kindly review the details below: Key Specifications:
insurance agency managementinsurance saleslocation headterritory managerbranch headbranch managerchief branch managerarea manager

Retail Head Location- Gurugram
THE TALENT KEEPERS 10.00 to 20.00 Years Gurugram 01 Apr, 2025

Knowledge of handling multiple stores with P&L accountability.

Understanding of Fusion software including opening of item masters, vendor codes, PO generations, and other aspects upto ...
inventorysupervisionmanagementstoreretailoperation

Required Tele Caller Dayshift
Sharda Consultancy Services 0.00 to 2.00 Years Gurugram,Delhi, Noida 01 Apr, 2025

Required Female Tele Caller for outbound domestic process.Good communication skills Salary - upto 15k working days - 6 days (Sunday off ) Shift Time - 10 AM to 7 pm Salary date...
outbound marketingdomestic bpotelesalesbposales

Software Development Manager
Sunil Kumar 1.00 to 6.00 Years Gurugram,Delhi, Bangalore, Chennai, Hyderabad 01 Apr, 2025

Please select which type of job you want to post: Please select which type of job you want to post: Please select which type of job you want to post: Please select which type of job you want t...
commysqlpythonajaxphpjavaapplication development

Sr.Finance Manager
Confidential 10.00 to 15.00 Years Gurugram 01 Apr, 2025

We are Hiring for Senior Finance Manager - SahiBandhu FinTech Services ( The Manipal Group) About Us:- SahiBandhu is Indias leading gold loan platform backed b...
gaapbenefits realisationcash flowrisk managementfinancial analysiserpfinancial reportingstakeholder managementerp software

Sr. Electrical Design Engineer
JustHR 8.00 to 13.00 Years Gurugram 01 Apr, 2025

Role: Electrical Engineer Location: Gurgaon, India Profession/Role type: Engineering/Individual Contributor Employment type: Full-Time About us Wearecreating a platform for passionate engineer...
powerautocadbuildingdistributiondesignetapengineerelectrical

Urgent | Hiring for Admission Head for Corporate Pre school at Gurugram
HR Globe Recruitment Service 3.00 to 8.00 Years Gurugram 01 Apr, 2025

Dear Candidates, Urgent | Hiring for Admission Head for Corporate Pre school at Gurugram Salary upto 55k Interested candidates please call hr on hidden_mobile 1. Me...
parent communicationcounsellinglead generationpreschoolonline lead generation

Video Editor - Advertising Agnecy
MEGMA SERVICES 2.00 to 4.00 Years Gurugram 01 Apr, 2025

ob description

Responsible for managing multiple video projects simultaneously. This includes understanding project requirements, establishing timelines and deadlines....
adobe premiere pro2d animationadobe photoshopmotion graphicsadobe after effectscameravideoadobe illustratortrackingeditor

Data Entry from home - No Experience Needed
VRD INFOTECH 0.00 to 1.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Bhopal 01 Apr, 2025

Dear candidate, We are seeking a meticulous Data Typing Specialist to join our team. Skills Needed: Basic computer knowledge Work Conditions: No age bar, no work pressure, no targets. Both ma...
data entryexcelback office

Data Entry Executive Work For Freshers,Part time work
VRD INFOTECH 0.00 to 1.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Bhopal 01 Apr, 2025

Dear Job applicant, It is one of the easiest part-time online jobs for candidates Position: Fresher /Computer Operator/ Data Entry Operator / backed office executive skills needed: basic compu...
exceltypingdata entry

Freelance Recruiter and Intern
KKD Consulting Hiring For KKD 0.00 to 1.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida, Sonipat, Palwal, Mumbai City, Meerut 01 Apr, 2025

Job Title: Freelance Recruiter & Recruitment Intern Location: Remote Job Type: Freelance / Internship
About Us:
[Y...
callingscreening

Sr HRBP Associate -Gurugram
MEGMA SERVICES 3.00 to 6.00 Years Gurugram 01 Apr, 2025

Leading engineering and construction company requires Sr HRBP Associate - Gurugram One of our client luxury brand which is Indias leading manufacturer of premium doors, windows, wood house and t...
hr operationshrbpassociate

Hvac Design Engineer
JustHR 14.00 to 20.00 Years Gurugram 01 Apr, 2025

Role: Lead/Principal Mechanical Engineer - HVAC Design Location: Gurgaon, India Profession/Role type: Engineering/Individual Contributor Employment type: Full-Time About us We arecreating a p...
designplumbingmepbimhvacrevitsystem

Manager Hrd
Employee deal consultants Hiring For A Reputed Readymade Garment Export House 15.00 to 25.00 Years Gurugram 01 Apr, 2025

A reputed garment export House is looking for a HR Head. The company has 3 units in Gurugram . HR Officers in all units will be gradualy reporting to him. The opening is based in Head Office and ...
hr compliancelabour lawshr generalist activitieslabour welfare

Linux Engineer
Angel and Genie 4.00 to 8.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

Linux (Plesk) Engineers role with us is a strategic bridge between development and IT operations, taking on operational tasks to ensure the efficient functioning of complete infrastructure and it...
linuxhatplesk

Quantity Surveyor
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Guwahati 01 Apr, 2025

Also known as cost consultants, quantity surveyors ensure building projects remain within budget. They provide cost and material estimates, draw up projected budgets, and work alongside a team, ...
quality managementquantity analysisquantity surveyingquality assurancequantity estimationquality control

Purchasing Assistant
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 12.00 to 22.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Panaji 01 Apr, 2025

Job brief We are seeking a detail-oriented Purchasing Assistant to join our team. Your main responsibility will be to order supplies and equipment in accordance with our companys needs. This...
purchasepurchase requisitionengineeringengineering designengineering managementproject engineeringpurchase management

Hiring For Online Marketing Executive (Work From Home Or Office Both) DELHI-NCR
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 01 Apr, 2025

Dear Candidate Greetings fromDesnor Destination Pvt Ltd ! Job Summary Idealises Internet Marketing Agency is looking for Marketing Executive to join our dynamic team and embark on a rewarding...
marketing planningdigitaldisplay advertisingmarketingfreelancingwork from homemarketing communicationpart time

Head Admin
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 5.00 to 10.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 01 Apr, 2025

Main Responsibilities:

Strategic Planning:

Identify opportunities for operational efficiency and cost savings within the administrative functions.

Prepare an...
administration managementoffice operationstravel deskfacility managementfacility operationscorporate administration

Full Stack Developer
LTIMindtree Limited 6.00 to 10.00 Years Noida,Hyderabad 01 Apr, 2025

Job Description Develop maintain enhance and test client systems of moderate to high complexity Execute full software development life cycle SDLC build highquality innovative and performing sof...
sdlcjavaaws

Quality Assurance Engineer
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 3.00 to 8.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

The QA technician role plays an important part in our companys product development process. Our ideal candidate will be responsible for conducting tests before product launches to ensure softwar...
automation testingmanual testingprocessqa analystquality analysttest engineerqualitytestingtest managerqa manager

Workforce Management Consultant
DIGITALCUBE CONSULTANCY SERVICES PRIVATE LIMITED 8.00 to 10.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

Designation: Workforce Management Consultant Experience Required: 8 years Work Mode: WFH Key Responsibilities: kronos timekeepingkronos wfcwfmsap hrpro

Business Development Manager
ADITYA BIRLA SUN LIFE INSURANCE COMPANY LIMITED 1.00 to 2.00 Years Gurugram,Delhi, Faridabad, Ghaziabad 01 Apr, 2025

Designation:Agency Manager Education:Any Graduates Experience:Fresher with Good network / Min. 1 Yearin anyDomain Sal...
salesinsuranceagency channelbfsi sales

Data Entry Operator-Work From Home-Computer Work-Typing Work Fresher (Delhi-NCR)
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 01 Apr, 2025

Dear Candidates, were seeking a skilled data entry operator to join our data team. In this role, youll manage essential data input tasks, such as ensuring data accura...
work from homeback officefreelancingdata entrypart timehome based data entrytypingstudentsfresher

Hiring AR Caller
Starworth Global Solutions 1.00 to 5.00 Years Gurugram,Noida, Jaipur, Chennai, Pune, Mumbai City 01 Apr, 2025

Hiring AR Caller Location:Pune,Mohali,jaipur,Noida,Gurgaon,Chennai,Trichy Work from office night shift Exp;1-5 years Ctc:max 5.5lpa All Documents must PF Mandatory Immediate Joiner to 15 ...
denialsphysician billingar calling

office itor
ASSETCARE SERVICES PRIVATE LIMITED 1.00 to 5.00 Years Gurugram,Delhi, Faridabad, Bangalore, Chennai, Hyderabad, Kolkata, Chittoor, Chandigarh, Ahmedabad 01 Apr, 2025

Janitors work to keep schools, offices, libraries, and hospitals, clean and maintained. They are often asked to work outside normal business hours sometimes early in the morning or late at night ...
adaptabilitycommunication skillsindependencetime managementproblem-solvingphysical stamina

Applications Developer
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 13.00 to 23.00 Years Gurugram,Delhi, Noida, Jaipur, Bangalore, Jaisalmer, Chennai, Hyderabad, Pune, Guwahati 01 Apr, 2025

Job brief We are seeking a qualified and talented Application Developer to join our team. In this role, you will be responsible for designing and coding functional programs and applications. ...
architecture governancevalue engineeringconstruction managementdeveloper/d2kengineeringapplication architecture

NTT DATA Virtual Drive Hedge Fund Gurgaon
NTT DATA INFORMATION PROCESSING SERVICES PRIVATE LIMITED 1.00 to 3.00 Years Gurugram 01 Apr, 2025

NTT DATA is Hiring experienced candidates for Hedge Fund Accounting domain. Location:Gurgaon Sector 48 (Candor Techspace) Work from Office Only Shift ...
reconciliationhedge fundsnav calculationinvestment banking

PREV
NEXT

office administrative software Job Openings

Description Job Requirements Job Title Collection Manager-BIL, Personal Loan and MBL Functio... collections processcollection strategyrecovery managementconsumer debtcollection managementcollection systemsdebt collection

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c... product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing

Production Engineer Job Description Template We are searching for a reliable, innovative production engineer to oversee manufacturing processe... labordiagnosisreportingdocumentationcommunicationsafetyscheduling managementmanufacturing processes

Pipeline Engineer Job Description Template We are looking for a highly experienced pipeline engineer to design and develop a variety of pipeline... budgetingblueprintcommunicationrepairconstruction technologytechnical standards

About Us:

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Description Job Requirements Job Title Collection Manager-BIL, Personal Loan and MBL Functio...
collections processcollection strategyrecovery managementconsumer debtcollection managementcollection systemsdebt collection

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c...
product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing

Production Engineer Job Description Template We are searching for a reliable, innovative production engineer to oversee manufacturing processe...
labordiagnosisreportingdocumentationcommunicationsafetyscheduling managementmanufacturing processes

Pipeline Engineer Job Description Template We are looking for a highly experienced pipeline engineer to design and develop a variety of pipeline...
budgetingblueprintcommunicationrepairconstruction technologytechnical standards