project justification jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

project justification Job Openings

Showing 22951 - 23000 of 29744 Jobs

Junior Accountant for Garment Exports

Shree Chaitanya International 3.00 to 7.00 Years Noida 01 Apr, 2024

Finance

Accounts

Garment manufacturing

UHT Operator

MMK ENTERPRISES 5.00 to 10.00 Years Noida 01 Apr, 2024

commissioninginstallation

Java Springboot Senior Developer

Infosys Limited 0.00 to 2.00 Years Mangalore 01 Apr, 2024

digital transformation

performance engineering

Civil Technician

MILLENNIUM BABYCARES PRIVATE LIMITED 10.00 to 14.00 Years Mumbai City 01 Apr, 2024

tools

engineering

geotechnical engineering

design

walls

transportation engineering

data

collection

environmental engineering

Executive Assistant

MILLENNIUM BABYCARES PRIVATE LIMITED 15.00 to 23.00 Years Mumbai City 01 Apr, 2024

provides administrative support

executive assistant

Civil Engineer

SUNITA AGRI EXPORTS PRIVATE LIMITED 1.00 to 5.00 Years Mumbai City 01 Apr, 2024

Civil Engineer Responsibilities:

Developing detailed designs.
Doing feasibility assessments and site inspections.
Prepar...
civil supervisioncivil site engineeringcivil engineeringengineering design services

TELECOM SITE ENGINEER Saudi Arabia

GLOBAL WINGZ CAREERS Hiring For Engineering company 5.00 to 10.00 Years Mumbai City 01 Apr, 2024

Job Title

Industry of the Employer

Number of Vacancies

engineering servicestelecom engineeringmechanical engineering

Maintenance Engineer

KINAL GLOBAL CARE PRIVATE LIMITED 15.00 to 25.00 Years Hyderabad 01 Apr, 2024

Job description

bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above;

Minimum 8 years of experience in oil and ga...
maximoschedulingmaterial managementpackaginghydraulicsinstrumentationorder managementms projectutility maintenance

Maintenance Engineer

KINAL GLOBAL CARE PRIVATE LIMITED 2.00 to 7.00 Years Hyderabad 01 Apr, 2024

Job description

bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above;

Minimum 8 years of experience in oil and ga...
hydraulicsms projectmaximomaterial managementschedulingorder managementpackagingplant maintenanceinstrumentation

Construction Engineer

ENVICARE TECHNOLOGIES PRIVATE LIMITED 20.00 to 25.00 Years Hyderabad 01 Apr, 2024

Developing construction plans, blueprints, and technical drawings/documents

Overseeing and managing construction projects and engineering processes

general

construction

assistant

Area Sales Manager - Telangana

HARMAN International 8.00 to 10.00 Years Hyderabad 01 Apr, 2024

Sales

Business Development

Strategic Partnerships

Relationship Management

Market Analysis

Project Management

Retail Sales Strategies

Customer Liaison

Market Feedback

UX/UI Designer

NEUMERIC TECHNOLOGIES PVT LTD 3.00 to 8.00 Years Hyderabad 01 Apr, 2024

Title:UX/UI Designer

Job Type: Full Time Location: Dilsukhnagar/Gachibowli, TS Experience: 3-8 years

Key Responsibilities:

Key Respons...
mobile interfacesdrupalux designmobile web designdotnetnukeweb designingcss3html5

Civil Technician
MILLENNIUM BABYCARES PRIVATE LIMITED 10.00 to 14.00 Years Hyderabad 01 Apr, 2024

Civil technicians, also known as civil engineering technicians, contribute to infrastructure projects such as highway construction and bridge building by providing direct support to civil enginee...
toolsengineeringgeotechnical engineeringdesignwallstransportation engineeringdatacollectionenvironmental engineeringasphaltcivilmanagementretainingprojecthand

Executive Assistant
MILLENNIUM BABYCARES PRIVATE LIMITED 15.00 to 23.00 Years Hyderabad 01 Apr, 2024

We are looking for an Executive Assistant to perform a variety of administrative tasks and support our companys senior-level managers. Executive Assistants responsibilities include managing cale...
office equipmentword processingpowerpointcustomer serviceevent planningproject managementconference callsprovides administrative supportexecutive assistant

Civil Engineer
SUNITA AGRI EXPORTS PRIVATE LIMITED 1.00 to 5.00 Years Hyderabad 01 Apr, 2024

Civil Engineer Responsibilities:

Developing detailed designs.

Doing feasibility assessments and site inspections.

Prepar...
civil supervisioncivil site engineeringcivil engineeringengineering design services

Sr. Executive/ Asst. Manager/ Manager/ Sr. Manager/ Chief Manager/ AGM
KW GROUP 0.00 to 5.00 Years Delhi 01 Apr, 2024

Job Overview: 1. Knowledge about leasing & BD 2. Written & Verbal Communication 3. Able to handle query related with fit out 4. Able to understand Reports & generate report as per requirement ...
CoordinationExcelPowerPointWordLeasingBDWrittenVerbal CommunicationFit OutUnderstanding ReportsGenerating ReportsShowcasing ProjectsMaking PPTResolving Queries

Commercial Manager
SAHYOG RECRUITMENT AGENCY 15.00 to 25.00 Years Delhi 01 Apr, 2024

Commercial Manager Role & responsibilities

Maintain positive relationships with suppliers, Customers and distributors

Identifying emerging markets and oppor...
logistics operationsprocurement planning

Android App Development Internship in Ghaziabad
Samrat Motors 0.00 to 4.00 Years Ghaziabad 01 Apr, 2024

Selected Interns Day-to-day Responsibilities Include Gather requirements for project specifications Design user interfaces according to gathered requirements Develop and create the application,...
DesignDevelopStudy requirements

Maintenance Engineer
KINAL GLOBAL CARE PRIVATE LIMITED 15.00 to 25.00 Years Ghaziabad 01 Apr, 2024

Job description

bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above;

Minimum 8 years of experience in oil and ga...
maximoschedulingmaterial managementpackaginghydraulicsinstrumentationorder managementms projectutility maintenance

Maintenance Engineer
KINAL GLOBAL CARE PRIVATE LIMITED 2.00 to 7.00 Years Ghaziabad 01 Apr, 2024

Job description

bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above;

Minimum 8 years of experience in oil and ga...
hydraulicsms projectmaximomaterial managementschedulingorder managementpackagingplant maintenanceinstrumentation

Senior Engineer Pavement Design
WSP 6.00 to 10.00 Years Noida 01 Apr, 2024

technical background: 6 years of experience working within Roads/Pavement Engineering discipline Knowledge of UK/International pavement engineering demonstrated by the experience of pavement ...
PavementPavement DesignPavement MaterialsPavement EvaluationTechnical Report Writing

Facility Engineer
MILLENNIUM BABYCARES PRIVATE LIMITED 5.00 to 10.00 Years Delhi 01 Apr, 2024

We are looking for a facilities engineer to be responsible for the maintenance and improvement of our manufacturing plant. You will be responsible for assessing the facilitys resource req...
admin facilities managementproduction facilitiesfacility operationsfacilities engineeringfacilitated processfacility managementpublic administrationpublic financefacility administration

Senior Engineer - Energy Advisory
WSP 7.00 to 10.00 Years Noida 01 Apr, 2024

WSP is seeking a Senior Engineer-Energy Advisory with more than 7 years of experience to join our large and growing Environmental and Sustainability team to work with our Middle East Advisory Serv...
Building PhysicsEnergy EfficiencyIES VESimulationEnergy ConservationLEED Certified

Consulting Engineer
MILLENNIUM BABYCARES PRIVATE LIMITED 10.00 to 19.00 Years Delhi 01 Apr, 2024

A consulting engineer advises clients on the planning, design, and construction of projects. They can be licensed to practice any technical specialty, including but not limited to mechanical, ele...
project managementjenkinsproduct developmentazurejavaemerging technologiesdata analysisvirtualizationlinux

Engineer - Bridges
WSP 4.00 to 7.00 Years Noida 01 Apr, 2024

Role Summary The successful candidates role will be as a engineer/ designer within the CRC Transportation team in our Noida/Bengaluru office producing detailed structure/ bridge engineering desig...
Engineering designConstruction drawingsDocumentationProject managementCommunication skillsCivil EngineeringEarthquake EngineeringBridge engineeringTechnical ExcellenceHealthSafetyAnalysisdesignDesign software knowledgeReinforced concrete Desi

Plant Head/GM For Metal Industry
SAHYOG RECRUITMENT AGENCY 20.00 to 25.00 Years Delhi 01 Apr, 2024

Plant Head/GM For Metal Industry Greetings!! we are hiring Plant Head/GM for Lead Recycling Industry for Tirupati/Delhi NCR location . Role & responsibilities...
production planningplant operationsfactory administrationproduction managementplant management

Manager Civil
Ind-Swift Laboratories Ltd 9.00 to 13.00 Years Chandigarh 01 Apr, 2024

Job Overview A versatile and resourceful Civil engineer having experience in Pharma Industry (API & Formulation), FMCG & Chemical Industry. This position will provide opportunities to work on a ...
Civil EngineeringAPIFormulationChemical IndustryEngineering Project ManagementQuantity SurveyingSafety ManagementQuality ControlPharma IndustryFMCGProject Engineering DesignArchitecturalInterior RequirementsProcess LabsClean Room Finishes

Quality control Chemistry Analyst
Vibcare Pharma Pvt Ltd 2.00 to 6.00 Years Panchkula 01 Apr, 2024

Position Title: Chemist Analyst - Pharma Manufacturing Summary: The Chemist Analyst in Pharma Manufacturing is responsible for performing analytical testing and quality control assessments of raw...
HPLCdissolution testinganalytical method validationequipment qualificationUVVis spectroscopytitrationswet chemistry methodscGMP regulationsFDA guidelinespharmacopeial requirementsdata integrity principlesMicrosoft Office Suite

We are Hiring For Immigration consultant
A V Immigration and careers consultancy private limited 1.00 to 5.00 Years Chennai 01 Apr, 2024

Provide consultation services to address potential clients interest in Visas, including establishing the suitability of the candidates visa. The consultation will mainly be by email, telephone, a...
marketinginternationalbusiness developmentsales coordinationsalesdomestic sales

3D Visualizer
Shilpa Architects Planners Designers 1.00 to 5.00 Years Chennai 01 Apr, 2024

Architectural Visualizer (Junior - Mid level) About Us: Shilpa Architect is a dynamic and innovative architecture firm known for its commitment to design excellence and sustainable solutions. Wi...
3D ModelingRenderingCollaborationAutoCADSketchUp3ds MaxRevitVRayLumionAdobe PhotoshopAfter EffectsTexturingLightingPostProductionDeadline ManagementContinual Learning

Commercial Space interior Designer
Priti Singh Hiring For LinkHr 5.00 to 10.00 Years Chennai 01 Apr, 2024

1.Assistance to client for review and selection of vendor for execution of interiorwork. 2.Theinteriordesignconsultantshallpostoneprofessionallyqualifiedinteriordesign -Architectsnotlessthan5y...
interior designingdetailingsite

Business Analyst
Arting Digital 2.00 to 6.00 Years Chennai 01 Apr, 2024

Job Title: Business Analyst Experience: 2yr Location: Pune Budget: 42-45 LPA Education: Bachelors degree holder, preferably IT based Primary skills: Business Analyst, Product development, Adv...
Product developmentExcelVisioBusiness AnalystAdvanced Microsoft Office

SAP Extended Warehouse Management-Business Analyst
Accenture 2.00 to 6.00 Years Chennai 01 Apr, 2024

Project Role : Business Analyst Project Role Description : Analyze an organization and design its processes and systems, assessing the business model and its integration with technology. Assess...
SAP Extended Warehouse Management

C-Programmer - Fresher
SPIRO PRIME TECH SERVICES 0.00 to 4.00 Years Chennai 01 Apr, 2024

Company - Project Development and Training Company. Salary Fresher@7K. Programming Skill - C Programming. Development Skill - Embedded Project Development (Software/Hardware). Job & Intervie...
C Programming

Business Analyst
Yaali Bizappln Solutions 1.00 to 3.00 Years Chennai 01 Apr, 2024

Job Title : Business Analyst We are looking to hire a candidate for the role of Business Analyst who is ready to join immediately. You will work alongside other sales personnel and report directl...
Excellent writtenverbal communication skillsDiligentSelfstarterMultitaskingPositive attitude

Business analyst (Claims)
LTIMindtree 6.00 to 9.00 Years Chennai 01 Apr, 2024

TYE : 6 to 9 years Notice Period : immediate to 15 days Location : Chennai, Hyderabad BA claims : ESSENTIAL RESPONSIBILITIES Take a lead role with customers, Software Engineers, Architects, Ca...
Analytical SkillsCommunication SkillsReport WritingSQLCustomer ServiceLeadershipAgile Methodology

Area Manager
Market Xcel Data Matrix Pvt Ltd 3.00 to 7.00 Years Chennai 01 Apr, 2024

Company Description Market Xcel Data Matrix Pvt. Ltd. is a full-service market research firm headquartered in India, with experience across diverse industries. We provide customized market resear...
Project ManagementLeadershipMarket ResearchData AnalysisCommunicationPresentationMS Office

Team Lead, Technology, Project Management, Corporate Banking; Lead...
DBS Bank 8.00 to 12.00 Years Chennai 01 Apr, 2024

Business Function Technology and Operations (T&O) enables and empowers the bank with an efficient, nimble and resilient infrastructure through a strategic focus on productivity, quality & control...
Architectural DesignMonitoringLoggingTracingAutomated TestingData ManagementJIRALeadershipCommunicationCollaborationJavaPythonJavaScriptDevOpsAutomationJenkinsSite Reliability EngineeringSRECICDObservabilityAlertingCloud Platforms

Civil Technician
MILLENNIUM BABYCARES PRIVATE LIMITED 10.00 to 14.00 Years Chennai 01 Apr, 2024

Civil technicians, also known as civil engineering technicians, contribute to infrastructure projects such as highway construction and bridge building by providing direct support to civil enginee...
toolsengineeringgeotechnical engineeringdesignwallstransportation engineeringdatacollectionenvironmental engineeringasphaltcivilmanagementretainingprojecthand

Executive Assistant
MILLENNIUM BABYCARES PRIVATE LIMITED 15.00 to 23.00 Years Chennai 01 Apr, 2024

We are looking for an Executive Assistant to perform a variety of administrative tasks and support our companys senior-level managers. Executive Assistants responsibilities include managing cale...
office equipmentword processingpowerpointcustomer serviceevent planningproject managementconference callsprovides administrative supportexecutive assistant

Civil Engineer
SUNITA AGRI EXPORTS PRIVATE LIMITED 1.00 to 5.00 Years Chennai 01 Apr, 2024

Civil Engineer Responsibilities:

Developing detailed designs.

Doing feasibility assessments and site inspections.

Prepar...
civil supervisioncivil site engineeringcivil engineeringengineering design services

UHT Operator
MMK ENTERPRISES 5.00 to 10.00 Years Bangalore 01 Apr, 2024

Please find the below job Details: Required UHT Operator Commissioned of UHT Infusion Plant . Responsible to complete UHT production & Filling line project. Installation and commissioning commissioninginstallation

Data Analyst (Power BI, Python, SQL)- Internal Audit domain, Bangalore
Talent Leads HR Solutions Pvt Ltd 3.00 to 8.00 Years Bangalore 01 Apr, 2024

Qualification- Mba Finance / Mca Experience 3 years Location Bangalore BO. 5.5 Days working from Office Key responsib...
sqlpowerdata analysisdatapython

SAP Finance Subject Matter Expert (SME/Module Lead/Solution Architect)
AATRAL TECHNOLOGIES INDIA PRIVATE LIMITED 7.00 to 10.00 Years Bangalore 01 Apr, 2024

Job Title: SAP Finance Subject Matter Expert (SME/Module Lead/Solution Architect) Job Responsibilities:

Work as a SAP Finance Subject Matter Expert ...
sap fico - financial accounting / controllingsap ficofico

Product Owner Busines Analyst
WHITE HORSE MANPOWER CONSULTANCY (P) LTD 6.00 to 11.00 Years Bangalore 01 Apr, 2024

Required Product Owner: 4 years of product owner / business analyst / product management or related experience Business Analysis: 0-3 years of product owner / business analyst / product managem...
use casesdevopsazureagile project managementagile developmenttest case matrixazdo

Maintenance Engineer
KINAL GLOBAL CARE PRIVATE LIMITED 15.00 to 25.00 Years Bangalore 01 Apr, 2024

Job description

bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above;

Minimum 8 years of experience in oil and ga...
maximoschedulingmaterial managementpackaginghydraulicsinstrumentationorder managementms projectutility maintenance

Maintenance Engineer
KINAL GLOBAL CARE PRIVATE LIMITED 2.00 to 7.00 Years Bangalore 01 Apr, 2024

Job description

bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above;

Minimum 8 years of experience in oil and ga...
hydraulicsms projectmaximomaterial managementschedulingorder managementpackagingplant maintenanceinstrumentation

Sales Engineer
POST A RESUME 1.00 to 5.00 Years Bangalore 01 Apr, 2024

Qualification: B.E/B.Tech/Diploma in Electrical/Mechanical (Mandatory) Location :Ahmedabad/ Delhi/ Noida/Gurugram/ Andhra Pradesh/Hyderabad/ Telangana/ Bangalor...
saleshvac sales

Event Designer
MILLENNIUM BABYCARES PRIVATE LIMITED 5.00 to 10.00 Years Bangalore 01 Apr, 2024

Have you ever found yourself at a wedding or corporate event where you were awed by the detail put into the decor There is a very good chance an event designer was behind it all. Event designers...
tradetransportationlogisticsmanagementcorporatebudgetaudiovisualbudgetsexternalcommunityeventsgroundshows

Marketing Manager
MILLENNIUM BABYCARES PRIVATE LIMITED 13.00 to 23.00 Years Bangalore 01 Apr, 2024

An Email Marketing Manager utilizes email communication tools to market a company and increase brand awareness. They are experts in the usage of email communications and develop marketing strateg...
marketservicemarketinganalyticscampaignspowerpointcustomerresearchmanagementdigitalprojectntegratedstrong

PREV
NEXT

project justification Job Openings

Civil Engineer Responsibilities:

Job description bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above; Minimum 8 years of experience in oil and ga... maximoschedulingmaterial managementpackaginghydraulicsinstrumentationorder managementms projectutility maintenance

Job description bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above; Minimum 8 years of experience in oil and ga... hydraulicsms projectmaximomaterial managementschedulingorder managementpackagingplant maintenanceinstrumentation

Civil Engineer Responsibilities:

Job description bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above; Minimum 8 years of experience in oil and ga... maximoschedulingmaterial managementpackaginghydraulicsinstrumentationorder managementms projectutility maintenance

Job description bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above; Minimum 8 years of experience in oil and ga... hydraulicsms projectmaximomaterial managementschedulingorder managementpackagingplant maintenanceinstrumentation

Civil Engineer Responsibilities:

Job description bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above; Minimum 8 years of experience in oil and ga... maximoschedulingmaterial managementpackaginghydraulicsinstrumentationorder managementms projectutility maintenance

Job description bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above; Minimum 8 years of experience in oil and ga... hydraulicsms projectmaximomaterial managementschedulingorder managementpackagingplant maintenanceinstrumentation

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Job description

bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above;

Minimum 8 years of experience in oil and ga...
maximoschedulingmaterial managementpackaginghydraulicsinstrumentationorder managementms projectutility maintenance

Job description

bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above;

Minimum 8 years of experience in oil and ga...
hydraulicsms projectmaximomaterial managementschedulingorder managementpackagingplant maintenanceinstrumentation

Job description

bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above;

Minimum 8 years of experience in oil and ga...
maximoschedulingmaterial managementpackaginghydraulicsinstrumentationorder managementms projectutility maintenance

Job description

bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above;

Minimum 8 years of experience in oil and ga...
hydraulicsms projectmaximomaterial managementschedulingorder managementpackagingplant maintenanceinstrumentation

Job description

bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above;

Minimum 8 years of experience in oil and ga...
maximoschedulingmaterial managementpackaginghydraulicsinstrumentationorder managementms projectutility maintenance

Job description

bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above;

Minimum 8 years of experience in oil and ga...
hydraulicsms projectmaximomaterial managementschedulingorder managementpackagingplant maintenanceinstrumentation