promoting the uk as a study abroad destination jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

promoting the uk as a study abroad destination Job Openings

Showing 2301 - 2350 of 7383 Jobs

Career Opportunities: Associate Director (42068)

Incedo Inc 13.00 to 15.00 Years Mexico (Mexico) 22 Apr, 2025

Company Overview Incedo is a US-based consulting, data science and technology services firm with over 3000 people helping clients from our six offices across US, Mexico and India. We...

big data technologies data integration cloud computing etl processes security controls hive apache pig program manager telecom hadoop technical skillsimpala infrastructure leadership skillsdelivery lead

Career Opportunities: Senior Network Engineer (41340)

Incedo Inc 4.00 to 6.00 Years Mexico (Mexico) 22 Apr, 2025

Company Overview Incedo is a US-based consulting, data science, and technology services firm with over 3000 people helping clients from our six offices across the US, Mexico, and Ind...

network security management vulnerability assessments security device configuration security policy implementation technical support communicationdss program manager telecom ids/ips nist snort

Business Analyst | Qube Careers

qube cinema technologies pvt ltd 3.00 to 6.00 Years Chennai (Tamil Nadu) 22 Apr, 2025

Business Analyst Title: Business Analyst Location: Chennai State: Tamil Nadu Experience: 3 - 6 years S...

data analysis techniques database design development statistical techniques application business requirement gathering market research competence data mining sql xml big data information management javascript business objects

Business Analyst - L3
Wipro Technologies Ltd 5.00 to 10.00 Years Hyderabad/ Secunderabad (Telangana) 22 Apr, 2025

Wipro Limited Wipro Limited (NYSE: WIT, BSE: 507685, NSE: WIPRO) is a leading technology services and consulting company focused on building innovative solutions that address clients...
customer requirements gathering solution proposal communicationstakeholder engagement workflow analysis domain expertise development principal consultant test cases qa writing testing integration testing delivery management user acceptance

Business Analyst(Contract)
Wipro Technologies Ltd 5.00 to 8.00 Years Bengaluru/ Bangalore (Karnataka) 22 Apr, 2025

Role Purpose The purpose of the role is to liaison and bridge the gap between the customer and Wipro delivery team to comprehend and analyze customer requirements a...
customer engagement requirement analysis solution design project management domain expertise principal consultant test cases qa writing testing integration testing delivery management user acceptance

Senior Technology Architect - Java
Wipro Technologies Ltd 1.00 to 4.00 Years Pune (Maharashtra) 22 Apr, 2025

: Senior Technology Architect - Java Job Summary: Seeking a highly experienced and dynamic Senior Technology Architect / Presales professional / Practice Professiona...
java technologies expertise cloud proficiency (aws/azure) microservices architecture technical documentation skillsleadership and mentoring information technology spring software engineering oracle hibernate spring boot system architecture lea

QA | QC Engineer Job In GERMANY With Family
World wide Immigration Service Llp 3.00 to 8.00 Years Germany (Germany) 22 Apr, 2025

For more information Call or WhatsApp�us on� Nine Eight Seven Zero One Seven Zero Six Two Nine � Responsibilities:
Prepare QA/QC plans for...
QA Testing QA Process QC Quality Control Quality Assurance

Software Engineer Job In CANADA With Family
World wide Immigration Service Llp 3.00 to 8.00 Years Canada (Canada) 22 Apr, 2025

For more information Call or WhatsApp�us on� Nine Eight Seven Zero One Seven Zero Six Two Nine � Responsibilities:
Determine operational f...
software engineer software developer senior software engineer software programmer

Process Engineer
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 3.00 to 8.00 Years Delhi,Bangalore, Chennai, Hyderabad, Gurugram 15 Apr, 2025

Develop and implementation of Assembly systems for manufacturing within Power train operations. Development process of assembly station design for safety and ergonomics Aligned to standard Proc...
plant engineeringcadisomanufacturingproject managementauto

US-Based Soft Collection Process
Hirexcel Corporation 0.00 to 2.00 Years Mumbai City 15 Apr, 2025

We Are Hiring, Job Opening: US-Based Soft Collection Process(Bread) Next DOJ- 15th Apr 2025 Salary * 17,000 - 32,000 per month 2k Performance bonus 1k attendance bonus (upto...
communication skillscustomer supportinternational voice processlead generation

Admission Counsellor
ITM Edutech (ETPL) 1.00 to 6.00 Years Navi Mumbai,Mumbai City, Thane, Panvel 15 Apr, 2025

Exciting Interview Opportunity for Freshers & Experienced Candidates! Date:14th/ 15th/ 16th/ 17th/19th/21st/22nd/23rd/24th/25th April 2025 (2nd 4th Satu...
counsellingsaleslead generationstudent counselingbusiness developmentmarketingcounselor educationadmission counsellingcounsellor

Senior Project Executive
M/S B NANDI 11.00 to 19.00 Years Gurugram,Delhi, Noida, Oman, Saudi Arabia, Luxembourg, Kuwait, Bangalore, Mauritius, Chennai, Philip 15 Apr, 2025

Senior Project Manager Job Description The Senior Project Manager is responsible for leading teams to deliver projects that span across one or more business units. Will manage resources, sche...
project estimationproject managementproject management officeproject executionproject planning

Piping Engineer
RIANSHI DEVELOPERS PRIVATE LIMITED 2.00 to 7.00 Years Ghaziabad,Kurukshetra, Bhutan, Katihar, Vaishali, Rajahmundry, Karimganj, Janjgir Champa, Ireland, L 15 Apr, 2025

Job description Be part of the solution at Technip Energies and embark on a one-of-a-kind journey. You will be helping to develop cutting-edge solutions to solve real-world energy problems....
solid workspiping designmachine designequipment layoutpiping engineeringequipment modelingpiping layout

Supply Chain Executive
TEAMWORK CABLES PRIVATE LIMITED 17.00 to 25.00 Years Gurugram,Delhi, Noida, Bhubaneswar, Bangalore, Chennai, Hyderabad, Pune, Mumbai City, Jharsuguda 15 Apr, 2025

Supply Chain Management

Adhere to the safety rules/regulations/objectives. Provide leadership to suppl...
supplier quality assurancesupply managementcertified quality engineersupply chain managementproduct qualitycertified quality auditorquality proceduresiso management representative

Part time, full time and home based Internet work Typig Work (Delhi-NCR Only)
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 15 Apr, 2025

Job description,

Dear candidates, Home based job simple typing work, No Experience require basic knowledge of c...
typingwork from homedata entrypart timehome based data entryfreelancingfresher

Hiring For Online Marketing Executive (Work From Home Or Office Both) DELHI-NCR
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Delhi,Faridabad, Ghaziabad, Noida, Gurugram 15 Apr, 2025

Dear Candidate Greetings fromDesnor Destination Pvt Ltd ! Job Summary Idealises Internet Marketing Agency is looking for Marketing Executive to join our dynamic team and embark on a rewarding...
marketing planningdigitaldisplay advertisingmarketingfreelancingwork from homemarketing communicationpart time

Part Time Computer , Back Office Executive, Typist, Typing, Online Data Entry
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Delhi,Faridabad, Ghaziabad, Noida, Gurugram 15 Apr, 2025

Job Details, We are offering a Job. Data Entry Operator, Computer Operator, Back Office Executive, Typist Freshers and Experienced both can apply for this jobs. Po...
data entrywork from homefreelancingcomputer operatinghome basedhousewives

Part time, full time and home based Internet work Typig Work (Delhi-NCR Only)
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Delhi,Faridabad, Ghaziabad, Noida, Gurugram 15 Apr, 2025

Job description,

Dear candidates, Home based job simple typing work, No Experience require basic knowledge of c...
typingwork from homedata entrypart timehome based data entryfreelancingfresher

Supply Chain Executive
TEAMWORK CABLES PRIVATE LIMITED 17.00 to 25.00 Years Delhi,Noida, Bhubaneswar, Bangalore, Chennai, Hyderabad, Gurugram, Pune, Mumbai City, Jharsuguda 15 Apr, 2025

Supply Chain Management

Adhere to the safety rules/regulations/objectives. Provide leadership to suppl...
supplier quality assurancesupply managementcertified quality engineersupply chain managementproduct qualitycertified quality auditorquality proceduresiso management representative

HR Head-Operations
DIGITALCUBE CONSULTANCY SERVICES PRIVATE LIMITED 7.00 to 10.00 Years Ludhiana 13 Apr, 2025

Job Title:HRHead-Operations Location:Ludhiana Department:Human Resources Experience:7plus years J...
payrolltalent acquisition

Medical Writer
Divya Staffing Solution 0.00 to 4.00 Years Lucknow,Saharanpur, Dhule, Navi Mumbai, Pimpri Chinchwad, Udaipur, Vasco Da Gama, Panaji, Durgapur, 13 Apr, 2025

As a medical writer, you will be responsible for writing documents, articles, journals, brochures, and product manuals for our organization. You will cover topics in clinical trials, treatments, ...
healthcarecodingbillingpatient care

Executive Director
SPENTO PAPERS (INDIA) LLP 10.00 to 20.00 Years Kochi,Kasargod, Oman, Qatar, South Africa, Ahmedabad, Philippines, Chennai, United Arab Emirates, No 13 Apr, 2025

Executive Director Job Description Template We are seeking a self-driven and highly competent executive director to lead and influence our organization towards favorable growth,...
oversightbusiness developmentprocess improvementmedicaidcustomer satisfactioncustomer servicemedicare

Purchasing Manager
AZTEC SHIVA HANDICRAFTS AND ARTS PRIVATE LIMITED 3.00 to 7.00 Years Jodhpur,Other Rajasthan 13 Apr, 2025

Company Description AZTEC SHIVA HANDICRAFTS AND ARTS PRIVATE LIMITED is located in Jodhpur, Rajasthan, India. The company specializes in handcrafted arts and crafts, offering a unique range of pr...
Vendor managementInventory managementCommunication skillsInterpersonal skillsStrong negotiationProcurement skillsSupplier relationsSupply chain knowledgeAnalytical abilitiesProblemsolving abilitiesAttention to detailOrganizational skills

Manufacturing Systems Engineer
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 15.00 to 25.00 Years Jaipur,Noida, Bilaspur, Bangalore, Chennai, Hyderabad, Gurugram, Tirumala, Pune, Guwahati 13 Apr, 2025

Job brief We are looking for a Manufacturing Engineer to help us implement manufacturing processes that result in high-quality products. You need to have good knowledge of tool design and fa...
manufacturingengineering change managementconstruction engineeringengineeringmanufacturing engineeringconstruction

Safety Officer
Rainbow HR Consulting Services Private Limited 5.00 to 10.00 Years Jaipur,Kolkata 13 Apr, 2025

KEY RESPONSIBILITIES: He/She must be able to develop and implement EHS plans and strategies to achieve goal zero. He/She must conduct EHS training and drive EHS practices and st...
ehsconstruction safetyneboshhazard identificationhsesafety auditingsafety officer activitiesreal estatesafety officer

Digital Marketing Internship in Indore
Athena Study Abroad Limited, UK 0.00 to 4.00 Years Indore,Other Madhya Pradesh 13 Apr, 2025

Selected Interns Day-to-day Responsibilities Include Designing engaging posts for marketing Preparing content Advertising companys products on the right platform Generating and managing leads ...
DesigningAdvertisingLead GenerationMarketingIELTS Training

FH Engineering and Project
Aditya Birla Management Corporation Pvt Ltd 10.00 to 20.00 Years Kolkata,Bangalore, Noida, Chennai, Hyderabad, Gurugram, Pune, Mumbai City, Delhi 13 Apr, 2025

Plan, Manage & Execute all projects at ACML through all phases of design till commissioning. Conceptualize & develop project plans in line with business requirements. Evaluate project alternative...
leadershipcurriculum development

Consultant Pathologist
DEVRAJ INSTITUTE OF MEDICAL SCIENCES 4.00 to 8.00 Years Gwalior,Other Madhya Pradesh 13 Apr, 2025

We are looking for an experienced pathologist to be responsible for performing tests, laboratory work, and pathological research. Your duties will include analyzing bodily fluids and tissue sample...
analytical skillscommunication skillsspecimen analysislaboratory workpathological researchanalyzing bodily fluidsanalyzing tissue samplesdiagnose diseasemedical knowledgeresearch methodstesting methodsidentification methodstreatment methods

Business Development Intern
Career Mantra Education Services India 0.00 to 4.00 Years Gwalior,Other Madhya Pradesh 13 Apr, 2025

Skills: Sales Strategy, Lead Generation, Client Relationship Management, Communication Skills, Analytical Skills, Negotiation Skills, Presentation Skills, Company Overview Vedas Mantra Pvt Ltd i...
Sales StrategyLead GenerationClient Relationship ManagementCommunication SkillsAnalytical SkillsNegotiation Skills

Track and Field Coach
The Scindia School 3.00 to 7.00 Years Gwalior,Other Madhya Pradesh 13 Apr, 2025

Company Description Established by late Maharaja Madhav Rao Jayaji Rao Scindia in 1897, The Scindia School, Gwalior, is a renowned boys boarding school with a rich 122-year legacy. The school em...
Athletic trainingEffective communicationTeamworkTrackField coachingTraining programs development

Graphic Designer
Craftandcode Solutions Private Limited 1.00 to 5.00 Years Gwalior,Other Madhya Pradesh 13 Apr, 2025

Graphic Designer Experience: 1 2 Years Area Knowledge of Adobe Photoshop/Illustrator, Corel Draw. Ability to create fresh designs, banners for website & Social Promotions, logo images, icons, br...
Adobe PhotoshopIllustratorCorel Draw

Business Development Manager - Tourism
Grand Royal Tours P Ltd 2.00 to 6.00 Years Erode,Other Tamil Nadu 13 Apr, 2025

Company Description Welcome to Grand Royal Tours (P) Ltd., where our mission is simple: We Make Sweet Memories. With over two decades of experience in the travel industry, we specialize in creati...
TourismBusiness DevelopmentSalesCommunicationNegotiationTravel IndustryTamil LanguageCustomer Relationships

Senior Mechanical Design Engineer - Welding Fixture Exp must - Coimbatore
Forar Tech India Private Limited 5.00 to 10.00 Years Coimbatore,Other Tamil Nadu 13 Apr, 2025

1. Have in-depth knowledge related to Jigs & Fixtures (Welding) design and development. 2. Should be able to execute the Fixture design from scratch to end of delivery (3d Model & 2d Drawings). ...
Robotic weldingBearingsCylindersMotorsSolid WorksGDTJigsFixtures designClampsLM guidesExtrusionsPinsManual ClampingPneumatic clampingHydraulic clampingTolerance Stack up

Frontend Developer
KnowledgeQ Interactive Consultancy Services 1.00 to 5.00 Years Coimbatore,Other Tamil Nadu 13 Apr, 2025

Experience: 1 - 3 Years Educational Qualification: Diploma/ Graduation/ Post Graduation from any Recognized University Skill sets Expected: Advanced level knowledge in HTML, CSS, JavaScript, ...
HTMLCSSJavaScriptjQueryNPMAngularJSSASSNodejsES6TypeScriptReactJSReduxPhaserJSPixiJsPhysics Libraries

Dental Hygienist
LEADZN PRIVATE LIMITED 5.00 to 10.00 Years Coimbatore,Chennai, Hyderabad, Bangalore, Noida, Gurugram, Kolkata, Amritsar, Mumbai City, Delhi 13 Apr, 2025

We are searching for a knowledgeable dentist who can provide a range of services to our patients. The dentist will meet with patients, assess their dental health, perform scheduled cleani...
dental assistanceoral medicineoral canceroral pathologyneuromuscular dentistrydental public healthdentistsdental productsdental imaging

Hiring for Reltionship Manager
Good Life Consultants Hiring For ICICI Prudential Life Insurance 1.00 to 6.00 Years Coimbatore 13 Apr, 2025

Hiring for a Leading Banking Corporate. Criteria : Qualification : Degree Must Age : 22 - 30 Job Location : Erode Experience : Min 1 to7 Years Experience in Field Sales Salary : 2.5L to 4.5...
active learningcommunication skillssalesforceteam managementleadership skillstime managementcustomer relationship

Sales Executive Engineer
PROPMO SERVICES PRIVATE LIMITED Hiring For ProPMO Services 1.00 to 5.00 Years Coimbatore,Chennai, Bangalore, Pune, Mangalore, Hubli, Other Karnataka 13 Apr, 2025

Sales Executive Engineer Location:Bangalore, Gulbarga, Hubli, Belgaum, Coimbatore, Karnataka, Chennai, Pune, Mangalore Power Tools / Lubricants / Weldin...
sales supportfield salesbearingsdurable medical equipmentlead generationbusiness-to-businessmedical salessalesindustrial sales

ANM Anesthesiologist Genetics
ACHIEVERS SPOT Hiring For MEDICAL CODING 0.00 to 4.00 Years Coimbatore,Chennai, Hyderabad, Salem, Vellore, Nagercoil, Tirupati, Tirumala, West Godavari, Prakasa 13 Apr, 2025

Job Description Position: Medical Coder Ct: HR HR Shanmugapriya - hidden_mobile Medical Codi...
pharmacyphysiotherapymicrobiologymedical codingmicrobiologistm.pharmdentistphysiotherapistpharmacist

Piping Engineer
RIANSHI DEVELOPERS PRIVATE LIMITED 2.00 to 7.00 Years Katihar,Vaishali, Bhutan, Rajahmundry, Karimganj, Janjgir Champa, Ireland, Ghaziabad, Kurukshetra, L 13 Apr, 2025

Job description Be part of the solution at Technip Energies and embark on a one-of-a-kind journey. You will be helping to develop cutting-edge solutions to solve real-world energy problems....
solid workspiping designmachine designequipment layoutpiping engineeringequipment modelingpiping layout

Sales Engineer - Bhopal
Global Power Systems 1.00 to 5.00 Years Bhopal,Other Madhya Pradesh 13 Apr, 2025

Sales Engineer / Sales Executive Location Bhopal Monthly Salary Rs. 15000 - 30000 Extras Travelling allowance, Fuel allowance, Performance Bonus, Health insurance, PF Job Description Sales...
SalesCold callingNetworkingMarketingCommunication skillsMS ExcelMS WordMS PowerpointDirect inquiry generationClient followupPersuasion skills

Yoga Coach
ToneOpFit 2.00 to 6.00 Years Bhopal,Other Madhya Pradesh 13 Apr, 2025

Company Description TONEOPFIT is a venture of Bansa l Group and one of the initiatives in Bhopal focused on maintaining health through nutritious diet plans catering to diverse intolerances. Our ...
Yoga InstructionAshtangaVinyasaTeaching

Marketing Executive
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Bhagalpur,Patna, Bangalore, Chennai, Noida, Hyderabad, Gurugram, Pune, Delhi, Guwahati 13 Apr, 2025

Marketing executives coordinate and oversee campaigns geared at promoting products, services, and causes. Marketing executives are adept at a variety of platforms, including print and social med...
marketing researchmarketing communicationmarketing managementbrand managementmarketing

Piping Engineer
RIANSHI DEVELOPERS PRIVATE LIMITED 2.00 to 7.00 Years Katihar,Vaishali, Bhutan, Rajahmundry, Karimganj, Janjgir Champa, Ireland, Ghaziabad, Kurukshetra, L 13 Apr, 2025

Job description Be part of the solution at Technip Energies and embark on a one-of-a-kind journey. You will be helping to develop cutting-edge solutions to solve real-world energy problems....
solid workspiping designmachine designequipment layoutpiping engineeringequipment modelingpiping layout

Sales Officer
Hagnos Marketing and Consulting Private Limited 1.00 to 3.00 Years Agra 13 Apr, 2025

Job Title: Sales Officer - Business Loans
Location: Agra ...
business loanbusiness loans

Supply Chain Executive
TEAMWORK CABLES PRIVATE LIMITED 17.00 to 25.00 Years Pune,Bhubaneswar, Bangalore, Noida, Chennai, Hyderabad, Gurugram, Mumbai City, Jharsuguda, Delhi 10 Apr, 2025

Supply Chain Management

Adhere to the safety rules/regulations/objectives. Provide leadership to suppl...
supplier quality assurancesupply managementcertified quality engineersupply chain managementproduct qualitycertified quality auditorquality proceduresiso management representative

Supply Chain Executive
TEAMWORK CABLES PRIVATE LIMITED 17.00 to 25.00 Years Noida,Delhi, Bhubaneswar, Bangalore, Chennai, Hyderabad, Gurugram, Pune, Mumbai City, Jharsuguda 10 Apr, 2025

Supply Chain Management

Adhere to the safety rules/regulations/objectives. Provide leadership to suppl...
supplier quality assurancesupply managementcertified quality engineersupply chain managementproduct qualitycertified quality auditorquality proceduresiso management representative

Work From Home s in Computer Data Entry Work -Fresher also apply
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Noida,Delhi, Faridabad, Ghaziabad, Gurugram 10 Apr, 2025

Dear Candidates, We are looking for freshers and experienced candidates for work from home Excellent opportunity @ Data entry/Computer Operator Part time/Full time Jobs No Targ...
home based data entrytypingdata entryback officework from homefreelancingpart timestudentshousewives

Executive Director
SPENTO PAPERS (INDIA) LLP 10.00 to 20.00 Years Oman,Qatar, South Africa, Ahmedabad, Kochi, Philippines, Chennai, United Arab Emirates, North Korea, 10 Apr, 2025

Executive Director Job Description Template We are seeking a self-driven and highly competent executive director to lead and influence our organization towards favorable growth,...
oversightbusiness developmentprocess improvementmedicaidcustomer satisfactioncustomer servicemedicare

Sales Executive Engineer
PROPMO SERVICES PRIVATE LIMITED Hiring For ProPMO Services 1.00 to 5.00 Years Mangalore,Chennai, Bangalore, Hubli, Other Karnataka, Pune, Coimbatore 10 Apr, 2025

Sales Executive Engineer Location:Bangalore, Gulbarga, Hubli, Belgaum, Coimbatore, Karnataka, Chennai, Pune, Mangalore Power Tools / Lubricants / Weldin...
sales supportfield salesbearingsdurable medical equipmentlead generationbusiness-to-businessmedical salessalesindustrial sales

Finance Administration Analyst
ASSETCARE SERVICES PRIVATE LIMITED 1.00 to 5.00 Years Mangalore,Hyderabad, Chennai, Bangalore, Ghaziabad, Kottayam, Kolkata, Gurugram, Faridabad, Ahmedaba 10 Apr, 2025

Financial Management Analysts examine budget estimates for completeness, accuracy, and conformance with procedures and regulations. Analyze budgeting and accounting reports. Afinancial analyst tr...
analysissoftwareaccountingdataexcelcommunicationcollaborationmodelingspreadsheetfinancialmathematical

PREV
NEXT

promoting the uk as a study abroad destination Job Openings

Senior Project Manager Job Description The Senior Project Manager is responsible for leading teams to deliver projects that span across one or more business units. Will manage resources, sche... project estimationproject managementproject management officeproject executionproject planning

Job description Be part of the solution at Technip Energies and embark on a one-of-a-kind journey. You will be helping to develop cutting-edge solutions to solve real-world energy problems.... solid workspiping designmachine designequipment layoutpiping engineeringequipment modelingpiping layout

Job description,

Dear candidates, Home based job simple typing work, No Experience require basic knowledge of c... typingwork from homedata entrypart timehome based data entryfreelancingfresher

Job Details, We are offering a Job. Data Entry Operator, Computer Operator, Back Office Executive, Typist Freshers and Experienced both can apply for this jobs. Po... data entrywork from homefreelancingcomputer operatinghome basedhousewives

Job description,

Dear candidates, Home based job simple typing work, No Experience require basic knowledge of c... typingwork from homedata entrypart timehome based data entryfreelancingfresher

Job description Be part of the solution at Technip Energies and embark on a one-of-a-kind journey. You will be helping to develop cutting-edge solutions to solve real-world energy problems.... solid workspiping designmachine designequipment layoutpiping engineeringequipment modelingpiping layout

Job description Be part of the solution at Technip Energies and embark on a one-of-a-kind journey. You will be helping to develop cutting-edge solutions to solve real-world energy problems.... solid workspiping designmachine designequipment layoutpiping engineeringequipment modelingpiping layout

Job Title: Sales Officer - Business Loans

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Senior Project Manager Job Description The Senior Project Manager is responsible for leading teams to deliver projects that span across one or more business units. Will manage resources, sche...
project estimationproject managementproject management officeproject executionproject planning

Job description Be part of the solution at Technip Energies and embark on a one-of-a-kind journey. You will be helping to develop cutting-edge solutions to solve real-world energy problems....
solid workspiping designmachine designequipment layoutpiping engineeringequipment modelingpiping layout

Dear candidates, Home based job simple typing work, No Experience require basic knowledge of c...
typingwork from homedata entrypart timehome based data entryfreelancingfresher

Job Details, We are offering a Job. Data Entry Operator, Computer Operator, Back Office Executive, Typist Freshers and Experienced both can apply for this jobs. Po...
data entrywork from homefreelancingcomputer operatinghome basedhousewives

Dear candidates, Home based job simple typing work, No Experience require basic knowledge of c...
typingwork from homedata entrypart timehome based data entryfreelancingfresher

Job description Be part of the solution at Technip Energies and embark on a one-of-a-kind journey. You will be helping to develop cutting-edge solutions to solve real-world energy problems....
solid workspiping designmachine designequipment layoutpiping engineeringequipment modelingpiping layout

Job description Be part of the solution at Technip Energies and embark on a one-of-a-kind journey. You will be helping to develop cutting-edge solutions to solve real-world energy problems....
solid workspiping designmachine designequipment layoutpiping engineeringequipment modelingpiping layout