regional commercial finance jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

regional commercial finance Job Openings

Showing 25301 - 25350 of 26677 Jobs

Application Architect SAP HANA Development

IBM India Pvt Limited 0.00 to 4.00 Years Bangalore 06 Oct, 2023

optimization strategies

application architecture

Process Specialist

Infosys Limited 0.00 to 5.00 Years Bangalore 06 Oct, 2023

Team Lead

Infosys Limited 1.00 to 3.00 Years Bangalore 06 Oct, 2023

general ledger accounting

compatibility testing

conditional formatting

financial justification

We have requirement for Consultant Specialist

Birlasoft (India) Limited 2.00 to 4.00 Years Pune 04 Oct, 2023

design specifications

transportation management

Ceramic Engineer

SHRI PLACEMENT AND HR SERVICES Hiring For American Manufucturing Multinational company 4.00 to 5.00 Years Pune 04 Oct, 2023

Duties/Responsibilities

Design, develop and implement new and improved processes
Expected to work on all phases of development including material science...
apply composite ceramic material engineering principles. ceramic matrix composites . fabrication methods.ceramic composite material .

Business Development Professionals

Associated Recruitment & Management Services Pvt Ltd 15.00 to 25.00 Years Pune 04 Oct, 2023

Sales Executive

Teamspace Financial Services Private Limited 4.00 to 6.00 Years Pune 04 Oct, 2023

Sell two wheelers finance to potential buyers. Attend walk in customer of Authorized Showroom. Maintenance of all the Register-walk in/Follow up. Determined what ty...
car loanssalescasa

Sales Manager- Thane

MSPIRE VENTURES PRIVATE LIMITED 1.00 to 5.00 Years Pune 04 Oct, 2023

Cluster Manager housing finance

Morpheus Human Consulting Pvt Ltd 10.00 to 15.00 Years Pune 04 Oct, 2023

BM Manager Housing Finance - pune

Morpheus Human Consulting Pvt Ltd 6.00 to 9.00 Years Pune 04 Oct, 2023

lap

home loans

Sales Representative

SUPRO INFO SOLUTIONS PRIVATE LIMITED 2.00 to 5.00 Years Pune 04 Oct, 2023

hidden_mobile

hidden_email

Job description:<...
salesfmcg salesfinancemarketingcasabankingloansinsurance

Assistant Manager
Infosys Limited 1.00 to 6.00 Years Pune 04 Oct, 2023

Managing team Act as single point of contact for client (for Operational issues) Train team members on various processes and domain related requirements Identify and execute transformation project...
salesmisaccountstatbankingfinanceoperationstransformationPWSDeliverablesSource SelectionCPSRProject CharterDAWIAGovernment AcquisitionTeamingFederal ProcurementCommercial FinanceAsset Based Lending

Sr Corporate Account Manager - NTB-CORPORATE SALARY-Regional Sales Nagpur
Kotak Mahindra Life Insurance Company Ltd 3.00 to 6.00 Years Nagpur 04 Oct, 2023

product salesbanking productsrelationship buildingsales

Required candidate For Sales Manager Top Insurance Company Salary Upto 5Lac
Niyukti Management Consultants Hiring For Niyukti Management Consultants 4.00 to 9.00 Years Delhi 04 Oct, 2023

Required Agency Development Manager Life Insurance Co. Ltd. Location ,Delhi,Pune,Ahmedabad,Anand,Rajkot,Nagpur,Jaipur,Jodhpur,Kota,Udaipur salesdevelopmentbusinesssales development managersales managersales officerterritory sales managerbusiness managerrelationship manageragency manager

Deputy Manager Customer Advisory - Delhi
NINA S HR CONSULTANCY 5.00 to 7.00 Years Delhi 04 Oct, 2023

KEY RESPONSIBILITIES: Maximize Paid to Applied Business in coordination with Issuance/underwriting team and finance Handling Centralized welcome calling Process. Reduction in Discrepancy ratio. W...
new businessrelationship building

Credit Manager
ELITERECRUITMENTS Hiring For Banking 0.00 to 3.00 Years Mangalore 04 Oct, 2023

EliteRecruitments Hiring For Banking Credit Manager Job Description Credit Manager responsibilities include creating credit scoring m...
branch accountingbranch handlingloan operationsworking capital management

Manager Accounts & Finance
Balkan HR Services private limited 2.00 to 7.00 Years Mumbai City 04 Oct, 2023

Position : Manager Accounts & Finance Candidate should be CA with minimum 2 years post qualification experience in Corporate Accounting (Not with CA firm). Will be able to handle Accounts up to ...
accountsfinance

Product Manager Housing Finance
Morpheus Human Consulting Pvt Ltd 5.00 to 10.00 Years Mumbai City 04 Oct, 2023

Create product strategy documents that describe business cases, high-level use cases, technical requirements, revenue, and ROI. - Analyze market data to develop sales strategies and define produ...
presentation skillsproduct developmentcross functional team buildingproduct managementproduct strategies

Assistant Manager - Finance
Morpheus Human Consulting Pvt Ltd 0.00 to 2.00 Years Mumbai City 04 Oct, 2023

Job Title: Assistant Manager Financial Planning & Auditing - Mumbai Our client focus is to provide loans to low and middle-income individuals, who want to buy or build their own homes. A major...
ms worldchartered accountancychartered financial analystms excelfinancial planningfinancial auditingteam management

Graphic Designer
GFL RECRUITMENT PRIVATE LIMITED 1.00 to 3.00 Years Mumbai City 04 Oct, 2023

Job Description

Roles & Responsibilities:

Create designs, concepts, infographics, layouts and presentation designs based on knowledge of layout princ...
layout designhtml5cssinfographics

Senior Analytics Solutions Associate (Workforce Capacity Planning)
JPMorgan 7.00 to 9.00 Years Mumbai City 04 Oct, 2023

General Requirements for Role The Senior Analytics Solutions Associate is a part of the Capacity Planning Team within Workforce planning is responsible for call center capacit...
real time monitoringstrong analytical skillspower biservice levelproblem solvingsite operationsbusiness acumenmicrosoft officeanalytical skillscapacity planningcritical thinkingprogram managementworkforce planningservice excellenceoral commu

Regional Sales Manager, Area Sales Manager - Home Loans, LAP
AV Global Advisory Services 10.00 to 15.00 Years Hyderabad 04 Oct, 2023

Urgent Vacancy with Leading Bank Role - Regional Sales Manager/Area Sales Manager - Home Loans/LAP Location - Chennai, Hyderabad, Bangalore

Sourcing of Home Loan, Loan against Proper...
mortgagehome loanslap

Energy Advisor
MNR Solutions Pvt Ltd 1.00 to 6.00 Years Hyderabad 04 Oct, 2023

Urgent Hiring For Energy Advisor Profile/Field Sales Job Location Hyderabad Qualification- B.tech CTC - 2.5 lpa Ag...
field worksalesdirect sales

Energy Advisor- Channel Sales.
MNR Solutions Pvt Ltd 0.00 to 5.00 Years Hyderabad 04 Oct, 2023

Urgent Hiring for Energy Advisor- Channel Sales- Field sales. Experience-Fresher- 3 Years Qualification-B.E./B.Tech Salary- ...
b2c salesb2b salessalesdirect sales

Urgent hiring for Electrical Engineer Fresher
Karnataka Information Solution 0.00 to 4.00 Years Hyderabad 04 Oct, 2023

Job Description Electrical Engineer Educational Qualification: BE / B.Tech in Electrical Job Types : Fresher, Experienced Salary : Rs.25,000/- to 50000/- Responsibilities: Designing, maintain...
industrial controlproduction engineeringtransformersautomationswitchgearelectrical maintenancecontrol panelquality control

Civil Engineer
AppSoft Solutions 0.00 to 4.00 Years Gurugram 04 Oct, 2023

Looking For Civil Engineer Commercial architectural firm requires an experienced, highly technical Civil Engineer to join our team of design professionals. Were a progressive, tight-knit company...
cadcamautocadcad operator.cad engineerconstruction engineersite supervisordiploma civilproject engineer

Photographer
MS Services 1.00 to 2.00 Years Gurugram 04 Oct, 2023

Urgent Requirement for Photographer
Job Titles :- Assistant Photographer Responsibilities

work with clients to discuss the images they re...
commercial photographystudio photographystill photographyphotography studio

Bulk Manager - SME
Bajaj Finserv Lending Ltd 3.00 to 10.00 Years Delhi 04 Oct, 2023

* Duties and Responsibilities - Co-coordinating the pre and Post FCU activity with FCU agency H.O. on daily basis & reporting to H.O. Updating credit / marketing team regarding the FCU activitie...
bias for actionstrong analytical skillsdriving resultsmystery shoppinganalytical skillsmanagement skills

Senior Manager- EV Production -CV Operations-TMCV
Tata Motors Ltd 12.00 to 16.00 Years Delhi 04 Oct, 2023

The role is responsible for the timely delivery of EV Vehicles/ Other Vehicles as per the production plan by meeting productivity, quality & cost targets along with the implementation of ...
financesalesltdmisaccountancycontinuous improvement facilitationcost managementinspiring teams

Credit Manager
Aanya Placement Services 2.00 to 7.00 Years Chennai 04 Oct, 2023

Hiring For Banking:
Credit Manager We are looking to hire an experienced credit manager to oversee our companys lending process. As a credit ...
financerisk managementrisk

RM-Infrastruce Finance
BOYEN HADDIN CONSULTING AND TECHNOLOGY PRIVATE LIMITED 2.00 to 7.00 Years Chandigarh 04 Oct, 2023

#Infrastructure Finance #Banking #BFSI Sales #Corporate Banking Job Title : Relationship Manager Department : Infrastructure Finance Group Supervisory - No - To Achieve over all business targe...
salesbusiness loan

Alert Required Business Manager in Reputed Insurance Company
Niyukti Management Consultants Hiring For Niyukti Management Consultants 5.00 to 10.00 Years Chandigarh 04 Oct, 2023

Required Business Manager in Reputed Insurance Company. Location:-, Delhi,Jaipur,Gurgaon,Noida,Ghaziabad ,Kolkata Lucknow,Moradabad,Kanpur,Chandigarh Salary- Upto 4lakh Rimb Incentive Job Resp...
direct salessalesagency salesinsurance managermanager salesbranch managerrelationship managerterritory managersales executiveunit managerdistribution managerarea sales managerstore managersales officerassistant branch manager

Hiring For Back Office Executive
AKSHITA INTERPRISES 0.00 to 4.00 Years Chandigarh 04 Oct, 2023

We are looking to hire an experienced back office executive to join our busy back office team. As a back office executive, you will be reporting to the back office manager and assisting with vari...
back office operationsadministrationoffice administration

Area HEAD - Bancassurance Sales
SRI HR & INTEGRATED SERVICES 5.00 to 10.00 Years Chandigarh 04 Oct, 2023

Job description Planning

Undertake planning for achieving sales targets for the cluster

Develop sales targets for the branches within the cluster
<...
target planningleadership skillsbusiness developmentteam managementoverall administration

Hiring Agency Development Manager Salary Good
Niyukti Management Consultants Hiring For Niyukti Management Consultants 3.00 to 8.00 Years Chandigarh 04 Oct, 2023

Required Agency Development Manager Life Insurance Co. Ltd. Location ,Bhopal Ujjain,Gwalior,Jabalpur,Indore,Panipat,Hissar,Chandigarh,bahadurgarh,Kurukshetra, ...
salesdevelopmentbusinessbusiness managersales manageragency managersales development managersales officer

Cluster Manager Housing Finance Bangalore
Morpheus Human Consulting Pvt Ltd 10.00 to 15.00 Years Bangalore 04 Oct, 2023

Dear Candidate, Please find below JD Our client focus is to provide loans to low and middle-income individuals, who want to buy or build their own homes. A majority of the customers are first-t...
laphousing financehome loansarea sales managerbranch manager

Patternmakers, Wood
Krishna Consultancy Hiring For Schneider Electric 12.00 to 20.00 Years Bangalore 04 Oct, 2023

The wood pattern maker job description entails planning, designing, and fabrication of wooden sectional patterns which are used in creating the cavities into which molten metal is poured during c...
pattern makingmechanical skillscommercial operationseye for details

Customer Support
LTIMindtree Limited 0.00 to 1.00 Years Bangalore 04 Oct, 2023

LTIMindtree is a global technology consulting and digital solutions company that enables enterprises across industries to reimagine business models, accelerate innovation, and maximize growth by ...
customer supportcustomer service

SAP HCM Payroll Consultant - Switzerland/Germany
Bosch Group 5.00 to 7.00 Years Bangalore 04 Oct, 2023

Job Description JD 1We are looking for a highly motivated and experienced SAP HCM Switzerland Payroll Consultant to join our team. The ideal candidate will have a deep understan...
payrollmisaccountancyfinancesap hcmsystem configurationfinancial justificationsaphcmtaxidealgermantrainingconsultingregulationscommunicationimplementationESSSAP PA

Regional Franchise Business Development Manager Ahmedabad
H K Jewels Private Limited 12.00 to 20.00 Years Ahmedabad 04 Oct, 2023

Regional Franchise Business Development Manager-
Job description

Kisna Real Diamobd Jewellery Urgently Required Franchise BDM (Hyderabad/Vijaywada OR Viza...
strategizesranchisee developmentfranchise signups

Require Regional Franchise Business Development Manager- Ahmedabad
H K Jewels Private Limited 15.00 to 20.00 Years Ahmedabad 04 Oct, 2023

Regional Franchise Business Development Manager-
Job description

Kisna Real Diamond Jewellery Urgently Required Franchise RBM

O...
franchise signupsensuresstrategizes

Lead Accountant
Infosys Limited 1.00 to 6.00 Years Pune 03 Oct, 2023

Identify and execute transformation projects Act as a knowledge manager (Documentation, updating, version control) Ensure quality of the deliverables,
...
bank reconciliationaccount reconciliationbalancecustomer relationsmanagementfinancetransformationPWSDeliverablesSource SelectionCPSRProject CharterDAWIAGovernment AcquisitionTeamingFederal ProcurementCommercial FinanceAsset Based Lending

Junior Accountant
Infosys Limited 0.00 to 1.00 Years Pune 03 Oct, 2023

. 1.Basic Accounting knowledge. 2.Must have an interest in Accounting, SAP, and Finance. 3.Team Player and Target Oriented Invoice Processing- Po/ Non po Payment processing and banking Vendor quer...
bank reconciliationaccountsaccountingtallyaccountancyquery resolutionpayment processingfinancial justificationsapslavendorfinancebankingreportingmilestonesperformancereconciliationDrug Accountability

Consultant Specialist
Birlasoft (India) Limited 5.00 to 7.00 Years Pune 03 Oct, 2023

* OTM Technical Developer (5-7 Years) Location : Pune (ready to visit Pune location as per project demand) 5-7 Years of OTM & Supply chain (Including hands on OTM Saa...
bankingenvironmentdeliverydocumentationfinancesupply chain managementuse casessupply chainuser storiesuser trainingorder managementservice deliverytraining materialcompatibility testingbusiness requirementsalternative solutionstransportati

Hiring For Sales Officer - Nagpur
ESSAE DIGITRONICS PRIVATE LIMITED 1.00 to 5.00 Years Nagpur 03 Oct, 2023

Job Title: Sales Officer /Territory Manager Report to: Regional Manager Required Qualification: Any Degree, MBA, Diploma, BE, Diploma Experience required: 1-4yrs We need Male candidatefromWei...
industrial machineryheavy machineryindustrial productsmaterial handling equipmentsindustrial salesb2b salescapital equipmentsheavy equipmentearth moving

Branch Manager Housing Finance - delhi
Morpheus Human Consulting Pvt Ltd 7.00 to 9.00 Years Delhi 03 Oct, 2023

Our client focus is to provide loans to low and middle -income individuals, who want to buy or build their own homes. A majority of the customer are first time home buy...
communication skillscollection managementbusiness developmentsalesprocess of sourcingbtl marketing

Applications invited for General Manager / Chief Engineer (Electrical) at APMD
Amity University 5.00 to 14.00 Years Noida 03 Oct, 2023

Applications invited for General Manager / Chief Engineer (Electrical) at APMD - 12-10-2022 - Adv/AUUP/HR/21/093 Advertisement Date: 12-10-2022 Adv/AUUP/HR/21/093 AMITY UNIVERSITY We at Amity Powe...
mechanicalsafetymachineryhvacplumbingair conditioningpower managementcommunication skillsverbal communicationelectrical engineeringpansolarsoundresumeengineersmanagement

Hiring National Distribution Manager for reputed Electronics Company
POST A RESUME 10.00 to 20.00 Years Mumbai City 03 Oct, 2023

To put in new route to market in low share low reach geographies across the country. Key Objectives : - Planning and execution of Distributor geographies. - S...
dealer salesdealer channel managementsalesdealer developmentdealer managementmarketing

Finance Mgr Payroll
Amazon 3.00 to 5.00 Years Hyderabad 03 Oct, 2023

Amazon.com employs more than 1 Million staff worldwide. As the company continues to scale, we are seeking Fin Ops Manager to lead and further develop the Payroll Financial Operations team at the H...
root cause analysisus payrollroot causereport writingbehavioral trainingfinancial operationsemployee developmentcontinuous improvementestablishing prioritiespaysetrootfinancepayrollwritingworkdaymetricstraining

Purchase Coordinator
NUPLANET VENTURES INDIA PRIVATE LIMITED 3.00 to 5.00 Years Delhi 03 Oct, 2023

Roles and Responsibilities: Sourcing and Procurement: Identify and source suppliers, products, and materials needed for the organizations operations while ensur...
salespurchase orderb2b salescommunication skillsvendor managementdocumentation

PREV
NEXT

regional commercial finance Job Openings

Job Description

Roles & Responsibilities:

Urgent Requirement for Photographer

Job Titles :- Assistant Photographer Responsibilities work with clients to discuss the images they re... commercial photographystudio photographystill photographyphotography studio

Hiring For Banking:

Credit Manager We are looking to hire an experienced credit manager to oversee our companys lending process. As a credit ... financerisk managementrisk

Job description Planning Undertake planning for achieving sales targets for the cluster Develop sales targets for the branches within the cluster <... target planningleadership skillsbusiness developmentteam managementoverall administration

Job description Kisna Real Diamobd Jewellery Urgently Required Franchise BDM (Hyderabad/Vijaywada OR Viza... strategizesranchisee developmentfranchise signups

Job description Kisna Real Diamond Jewellery Urgently Required Franchise RBM O... franchise signupsensuresstrategizes

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Job Titles :- Assistant Photographer Responsibilities

work with clients to discuss the images they re...
commercial photographystudio photographystill photographyphotography studio

Credit Manager We are looking to hire an experienced credit manager to oversee our companys lending process. As a credit ...
financerisk managementrisk

Job description Planning

Undertake planning for achieving sales targets for the cluster

Develop sales targets for the branches within the cluster
<...
target planningleadership skillsbusiness developmentteam managementoverall administration

Job description

Kisna Real Diamobd Jewellery Urgently Required Franchise BDM (Hyderabad/Vijaywada OR Viza...
strategizesranchisee developmentfranchise signups

Job description

Kisna Real Diamond Jewellery Urgently Required Franchise RBM

O...
franchise signupsensuresstrategizes