software measurement jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

software measurement Job Openings

Showing 6851 - 6900 of 32806 Jobs

.NET Developer

FinJo Fresher Khordha 24 Sep, 2025

NET CoreNET Framework

ASPNET MVC

Web API

Entity FrameworkEF Core

RESTful services

presales consultant

BSH TECHNOLOGIES PRIVATE LIMITED Fresher Bhubaneswar 24 Sep, 2025

Work closely with the Business Development & Sales teams to support lead qualification and opportunity conversion.
Conduct r...
crmpresentationsclientsmbsoftwaresalestoolsexcelpowerpointdemosmarketproposalsstrongmandatory.knowledgesystems.serviceslikeestimationsusing

Hiring For Quality Analyst

DEVIKA STAFFING SOLUTION Fresher Raipur, JabalpurJabalpur, Dehradun, Jaipur, Indore, Jodhpur, Kota, Udaipur, Bikaner, Patna 24 Sep, 2025

Hiring For Quality Analyst

DEVIKA STAFFING SOLUTION Fresher Raipur, BhillaiBhillai, Bhubaneswar, Odisha, Dhule, Bokaro, Dhanbad, Ranchi, Asansol, Wardha 24 Sep, 2025

Vacancy for Machine Learning Engineer

DEVIKA STAFFING SOLUTION Fresher Raipur, BhubaneswarBhubaneswar, Cuttack, Jaipur, Sikar, Jodhpur, Kota, Udaipur, Ranchi, Bikaner 24 Sep, 2025

Hiring For Machine Learning Engineer

DEVIKA STAFFING SOLUTION Fresher Patna, BhagalpurBhagalpur, Gopalganj, Bihar, Mohali, Bokaro, Dhanbad, Korba, Solan, Raigarh 24 Sep, 2025

Store Manager Dabur India Limited

sk online services Fresher Patna, BiharBihar, JammuKashmir, Gujarat, Madhya Pradesh, Ahmednagar, Jharkhand, Karnataka, Himachal 24 Sep, 2025

Job Title: Store Manager Company: Dabur India Limited leadershipmanagementcommunication skillsmaterial receiptstore managementdispatchwarehouse operationsstock control

Dot Net Developer
RAJKAMAL BARSCAN SYSTEMS PVT LTD Fresher Patna, KolkataKolkata, Bangalore, Chennai, Noida, Hyderabad, Gurugram, Pune, Mumbai City, Delhi 24 Sep, 2025

Software Developer (.NET|.NET Core) Experience: 2 Years Location: Andheri East, Mumbai and Remote ________________________________________ Key Skills

Technologies:...
mvc frameworkdesignproceduresdatabaseweb applications.net coremssqlstoredentity framework / ef corewindows applicationscustomer support / technical issue resolution.net developer

Hiring For Machine Learning Engineer
DEVIKA STAFFING SOLUTION Fresher Pondicherry, CoimbatoreCoimbatore, Chennai, Bangalore, Bidar, Gulbarga, Vellore, Hosur, Mangalore, S 24 Sep, 2025

To ensure success as a machine learning engineer, you should demonstrate solid data science knowledge and experience in a related ML role. A first-class machine learning engineer will be someone ...
software testingtestinghardware testingquality

Vacancy for Machine Learning Engineer
DEVIKA STAFFING SOLUTION Fresher Pondicherry, CoimbatoreCoimbatore, Chennai, Bangalore, Bidar, Vellore, Gulbarga, Hosur, Mangalore, S 24 Sep, 2025

Machine learning engineers are IT programmers who create software that provides computers and machines with the ability to function, learn and improve on their own (without being directed by huma...
testingsoftware testinghardware testingmanual testing

Dot Net Developer
Ariel Software Solutions Fresher Punjab 24 Sep, 2025

You have an exciting opportunity to join our team as a Software Developer in Mohali, Punjab. With 1 to 4 years of experience, you will be responsible for creating top-quality applications and mana...
NETHTMLCSSJavaScriptAJAXjQueryBootstrapAngularJSSQL ServerMYSQLMongoDBPostgreSQLAutofacUnityNinjectNUnitXUnitMSTestNET languages CNET framework MVCNETWeb APIReactJSNET 45Net CoreEntity Framework 6EF CoreNHibernateADONETDepende

Make Up cum Salon Manager (Female)
Hair Raiserz Luxe Fresher Punjab 24 Sep, 2025

You are seeking a Professional Make Up Artist cum Salon Manager (Female Only) to oversee the day-to-day operations of the salon. Your responsibilities will include supervising staff, managing sche...
Developing Marketing StrategiesFinancial TransactionsMicrosoft OfficeMake Up ArtistSalon ManagerSupervising StaffManaging SchedulesMarketing ServicesMaintaining Financial RecordsManaging InventoryAddressing Customer ConcernsIndustry Trends

Senior 3D Artist
ChicMic Studios Fresher Punjab 24 Sep, 2025

Role Overview: You will be a skilled and imaginative 3D Artist joining our team, with a strong foundation in 3D modeling, texturing, and rendering. Your main responsibility will involve collaborat...
3D modelingtexturingrenderingBlenderMayaZbrushSubstance PainterUnreal EngineUnityMarvelous DesignerKeyshotanimationriggingMarmoset ToolbagRoblox

Magento 2 Developer
Sookshum Labs Technologies Private Limited Fresher Punjab 24 Sep, 2025

As a Magento Developer at Sookshum Labs, your primary responsibility will be to develop, customize, and maintain Magento 2-based websites. You will collaborate closely with a team of developers to...
HTMLCSSJavaScriptAPIsjQueryPHPRESTSOAPUI DesignAWSGCPCommunication SkillsMagento Best PracticesRelational Database SystemsObjectOriented ProgrammingProblemSolvingOrganizational SkillsGIT Version Control

Inside Sales Manager
HALSEEON SOLUTIONS PRIVATE LIMITED Fresher Mysore, ChennaiChennai, Bangalore, Madurai 24 Sep, 2025

Position Overview We are seeking a dynamic and results-driven Inside Sales Manager to join our team. This role is pivotal in driving our sales initiatives and expanding our m...
market researchsales strategysales promotionsales administrationsalesmarketing

Business Process Optimization Manager
University of the People Fresher Mysore, Karnataka 24 Sep, 2025

As a Business Process Optimization Manager at University of the People (UoPeople), you will be responsible for leading and managing the optimization of business processes across the organization. ...
Business Process OptimizationProcess ImprovementLeadershipLeanSix SigmaBPMData AnalysisProject ManagementCommunication SkillsInterpersonal SkillsStrategic ThinkingAnalytical Abilities

Digital marketing video and poster editing freshers 3 months unpaid internship
software development and graphic design Fresher Madurai, Tamil Nadu 24 Sep, 2025

Role Overview: As a Digital Marketing Video and Poster Editing Intern at our dynamic software development and graphic design company, located in Madurai, you will be responsible for assisting in c...
Social Media MarketingOnline MarketingDigital MarketingWeb AnalyticsCommunication skillsCollaborationAttention to detailCreativity in visual content creationEnthusiasm for learningAdapting to new technologies

Territory Sales Manager
Confidential Fresher Madurai 24 Sep, 2025

Role & Responsibilities We are looking for a Software Engineer with 3 to 6 years of experience in developing, configuring, and customizing Product Lifecycle Management (PLM) sol...
javascriptrallyautomationjirarobotseleniumgoodpycharmtestingpythonframework

Senior Telesales Executive
HALSEEON SOLUTIONS PRIVATE LIMITED Fresher Madurai, ChennaiChennai, Bangalore, Mysore 24 Sep, 2025

Job Title: Senior Telesales Executive

Position Overview We are seeking a dynamic and results-driven Senior Telesales Executive to join our growing team. This role is pivotal in driv...
software marketingsoftware salestelesalestelemarketingtelecom salestelecalling

Inside Sales Manager
HALSEEON SOLUTIONS PRIVATE LIMITED Fresher Madurai, ChennaiChennai, Bangalore, Mysore 24 Sep, 2025

Position Overview We are seeking a dynamic and results-driven Inside Sales Manager to join our team. This role is pivotal in driving our sales initiatives and expanding our m...
market researchsales strategysales promotionsales administrationsalesmarketing

Angular - Web Developer
Roots Infocomm Private Limited Fresher Ludhiana, Punjab 24 Sep, 2025

As a skilled Web Developer, you will be responsible for developing and/or designing web applications while collaborating with a team of developers. Your role will involve creating, maintaining, an...
AngularJavaScriptHTMLCSS

Hiring For Quality Engineer
DEVIKA STAFFING SOLUTION Fresher Ludhiana, ChandigarhChandigarh, Sikar, Nagaur, Navi Mumbai, Thane, Kharagpur, Pune, Mumbai City, Bhi 24 Sep, 2025

were seeking an experienced quality engineer to build upon this reputation with an unwavering commitment to meticulous production. The ideal candidate is an exceptionally organized, methodical pr...
maintenancesupervisionquality

Sales Associate ( Noida )
CONSULTBAE INDIA PRIVATE LIMITED Fresher Lucknow, NoidaNoida, Kolkata 24 Sep, 2025

Position:Sales Associate (Sales & Ops) Exp:1 Years Working Mode:WFO, 5 Days Location:Noida,Kolkata, Lucknow Role ...
automobile salessales

Public Relations Officer
Divine Heart & Multispeciality Hospital Fresher Lucknow, Uttar Pradesh 24 Sep, 2025

Role Overview: You are currently seeking a dynamic and experienced Public Relations Officer (PRO) with a background in the hospital industry to join the team at Divine Heart & Multispeciality Hosp...
Public RelationsMedia RelationsCommunicationInterpersonal SkillsCrisis CommunicationStrategic Planning

Logistics Officer
SHARMA ENTERPRISES Fresher Kakinada, GunturGuntur, Hyderabad, Kurnool, Nellore, Guntakal, Anantpur, Dhubri, Dibrugarh, Guwahati 24 Sep, 2025

We are looking for a detail-oriented and organized Logistics Officer to join our team. The Logistics Officer will be responsible for coordinating the transportation, storage, and distribution of ...
supply chain managementcustomer serviceinventory managementproblem solvingadaptabilitylogistics managementdelivery operationsteamwork

Executive assistance
ASSETCARE SERVICES PRIVATE LIMITED Fresher Kakinada, HyderabadHyderabad, Ongole, Kadapa, Chittoor, Bangalore, Chennai, Gurugram, Kolkata, Delhi 24 Sep, 2025

An executive assistantprovides high-level administrative support to senior management by managing schedules, coordinating meetings, handling communications, preparing reports,...
communicationtechnicaldetailexperienceattentionproficiencyproblem-solvingorganizational

Content & Copywriting Intern/Trainee
Marketing as Sales support Fresher Kochi, Kerala 24 Sep, 2025

Role Overview: As a part of MaSs, a digital marketing agency based in the UK with operations in Kochi, you will be part of a team that focuses on vibe marketing - creating messages that stand out,...
CopywritingContent CreationEditingGrammarAdaptabilityFeedbackCreativityAI Tools

Software Developer (Full Stack)
EY Fresher Kochi, Kerala 24 Sep, 2025

Role Overview: At EY, youll have the opportunity to build a unique career with global scale, support, inclusive culture, and technology to help you become the best version of yourself. Your unique...
SQLMicrosoft AzureAngularETL technologyMicrosoft Azure Data ServicesAzure Data FactoryDatabricksAzure Data Lake StoreDatabase conceptsData LakeWeb APIPowerBIPowerAppsPowerAutomatePMI

Front Office Administrator
DLIFE Home Interiors Fresher Kochi, Kerala 24 Sep, 2025

As a detail-oriented and proactive professional, your role involves managing front office operations and assisting with daily administrative tasks. Your responsibilities include greeting and assis...
Administrative SupportCustomer ServiceCommunication SkillsProblem SolvingAdaptabilityOffice Operations ManagementMicrosoft Office SuiteOffice Management SoftwareOrganizational Abilities

Software Tester
Blue Horizon Infotech Fresher Kochi, Kerala 24 Sep, 2025

Role Overview: You have 2 years of experience in Software Testing Automation using Selenium. You are proficient in creating Test Automation Resources such as Function Libraries and have the abilit...
SeleniumTest AutomationTest DataTest CasesTest ScriptsSelenium WebDriverJavaInterpersonal skillsCommunication skillsSoftware Testing AutomationFunction LibrariesDataDriven TestingTestNG AnnotationsDefect Management ToolReRegression Testing

Pricing Specialist
HastenWay Shipping Fresher Kochi, Kerala 24 Sep, 2025

Role Overview: You will be responsible for preparing competitive freight rates, handling rate negotiations, and coordinating with carriers and agents to secure the best possible deals. The ideal c...
NegotiationAnalytical SkillsCommunication SkillsMS OfficeCustomer Service

Junior Angular Developer
HighQ-Labs Pvt Ltd Fresher Kochi, Kerala 24 Sep, 2025

You will be responsible for developing and maintaining code in accordance with predefined cost, company, and security standards. Your role will involve working on bug fixes, supporting the mainten...
rest apiSQLMongoDBsoftware programmingHTMLCSSAngular 2Hibernate Java

Production Manager
YOUTAG INFOTECH PRIVATE LIMITED Fresher Jodhpur, JaisalmerJaisalmer, Bhiwadi, Navi Mumbai, Bankura, Uttar Dinajpur, Thane, Mumbai City, Daks 24 Sep, 2025

We are looking for an experienced Production Manager to organize and oversee the manufacturing of goods. You will be ultimately responsible for the smooth running of all production lines and the ...
prosperitypressure transient analysismbalproduction managementproduction engineeringtechnical productionnodal analysis

Vacancy for Machine Learning Engineer
DEVIKA STAFFING SOLUTION Fresher Jodhpur, UdaipurUdaipur, Jaipur, Sikar, Kota, Bikaner, Bhubaneswar, Cuttack, Raipur, Ranchi 24 Sep, 2025

Machine learning engineers are responsible for putting data into machine learning models and deploying these models in production. Ingestion and preparation of data is a tricky task. It must be a...
software testingtestinghardware testingquality

Executive Assistant
NARBHERAM MOTORS PRIVATE LIMITED Fresher Jamshedpur, Jharkhand 24 Sep, 2025

Role Overview: As an Executive Assistant at NARBHERAM MOTORS PRIVATE LIMITED in Jamshedpur, your primary responsibility will be to provide executive administrative support, handle expense reports,...
Executive Administrative AssistanceSchedulingVerbal CommunicationWritten CommunicationZoomExpense Reports ManagementOrganizational SkillsMicrosoft Office Suite

AVP/ VP- Energy Transmission & Distribution
HR JOBS CONSULTANCY Fresher Jamshedpur, RanchiRanchi, Bhubaneswar, Jaipur, Indore, Chennai, Noida, Lucknow, Kolkata, Bhopal 24 Sep, 2025

AVP/ VP- Energy Transmission & Distribution Study of system study improvement in the power distribution system. To prepare & execute BU plan for the next 5 years in consultation with Top Manage...
transmission planningtransmission systemstransmission line

Hiring For Data Scientist
DEVIKA STAFFING SOLUTION Fresher Ranchi, PatnaPatna, Jammu, Dehradun, Mohali, Srinagar, Raipur, Navi Mumbai, Chandigarh, Vasco Da Gam 24 Sep, 2025

we rely on insightful data to power our systems and solutions. Were seeking an experienced data scientist to deliver insights on a daily basis. The ideal candidate will have mathematical and stat...
software testingtestingqualityhardware testing

Hiring For Quality Engineer
DEVIKA STAFFING SOLUTION Fresher Dhanbad, RanchiRanchi, Hazaribagh, Patna, Jharkhand, Burdwan, Siwan, Gopalganj, Ahmedabad, Guwahati 24 Sep, 2025

Were seeking an experienced QA engineer to join our team You will be responsible for ensuring the quality of software products by identifying defects, conducting tests, and validating that the s...
maintenanceproductionquality

Vacancy for Machine Learning Engineer
DEVIKA STAFFING SOLUTION Fresher Ranchi, BhubaneswarBhubaneswar, Cuttack, Jaipur, Sikar, Raipur, Jodhpur, Kota, Udaipur, Bikaner 24 Sep, 2025

Machine learning engineers are responsible for putting data into machine learning models and deploying these models in production. Ingestion and preparation of data is a tricky task. It must be a...
software testingtestinghardware testingquality

Hiring For Machine Learning Engineer
DEVIKA STAFFING SOLUTION Fresher Bokaro, DhanbadDhanbad, Patna, Bihar, Bhagalpur, Mohali, Gopalganj, Korba, Solan, Raigarh 24 Sep, 2025

We are actively searching for a talented and experienced Machine Learning (ML) Engineer to join our team. As a Machine Learning Engineer, you will play a crucial role in the development and imple...
testingsoftware testinghardware testingmanual testing

Software Tester
Brightcode Software Services Fresher Ranchi, Jharkhand 24 Sep, 2025

As a Software Tester, you should possess a B.Tech (CS , IT) / BCA / MCA qualification and have 1 - 3 years of professional experience. Your responsibilities will include being strong in Database T...
Manual TestingDatabase testingSystem TestingBrowser TestingDefect ManagementAutomation Testing

Store Manager Dabur India Limited
sk online services Fresher Patna, BiharBihar, Gujarat, Himachal Pradesh, JammuKashmir, Jharkhand, Karnataka, Madhya Pradesh, Ah 24 Sep, 2025

Job Title: Store Manager Company: Dabur India Limited leadershipmanagementcommunication skillsmaterial receiptstore managementdispatchwarehouse operationsstock control

Accounts Analyst
YOUTAG INFOTECH PRIVATE LIMITED Fresher Ramgarh, Purbi SinghbhumPurbi Singhbhum, Hazaribagh, Dimapur, Bangalore, Paradeep, Hyderabad, Mokokc 24 Sep, 2025

We are looking for a Financial Analyst to provide accurate and data based information on companys profitability, solvency, stability and liquidity. You will research and analyze financial informa...
post-sale supportaccount executiveskey account developmentaccountingaccount expansionnational accountsspectraprospacedirect store delivery

Production Manager For Retail Luxury Company in Jaipur
Capital Placement Services Fresher Jaipur, Rajasthan 24 Sep, 2025

As a Production Manager/Master, you will be responsible for managing the production unit of custom high-end luxury furniture, cabinets, bags, and wallets within the Leather & Metal industry. Your ...
WoodBagsProduction Manager

Internship Trainee(Live project trainee 3 to 6 month 8 hours per day get exp
Guidance Placement Hiring For - Fresher Jaipur, NoidaNoida, Delhi, Gwalior, Kanpur, Gurugram, Bhopal, Agra, Patna 24 Sep, 2025

fresher job web developer/php/react/flatter/web design/graphics delhi Interview going on Freshers or expyou can call this no hidden_mobile Noida its going on ...
androidlaravelangular jsphpreact.jsweb designingsoftware developersweb developerfull stack developer

Senior Java Developer
Delta Sys-Tech (India) Pvt Ltd Fresher Ahmedabad 24 Sep, 2025

Permanent job opening for Java Fullstack Developer with US MNC organization at Ahmedabad Job Description Years of experience 6 9 / 9 - 12 years spring bootjavastackangularjshibernatemicroservicescore javareact.jsdeveloper

Frontend Developer - Reactjs
Webential Technologies Pvt Ltd Fresher Ahmedabad, Gujarat 24 Sep, 2025

As a Frontend Developer at Webential Technologies in Ahmedabad, you will be responsible for designing, developing, and implementing scalable web applications from front to back. You should have 2 ...
JavaScriptDOMGitReactjsNextjsHTML5CSSTypescriptBrowser EventsJavaScript APIsCanvas renderingBabelPostCSSWebpack

Civil Design Engineer
Delta Sys-Tech (India) Pvt Ltd Fresher Vadodara 24 Sep, 2025

Location:Vadodara, Gujarat Role: Civil Design Engineer Exp...
autocadsurveystadd procivil designroot mapsag tension calculationscivil erectionloading calculations

Hiring For Data Scientist
DEVIKA STAFFING SOLUTION Fresher Ahmedabad, VadodaraVadodara, Odisha, Andhra Pradesh, Assam, Gujarat, Himachal Pradesh, Kerala, Tamil 24 Sep, 2025

looking for a machine learning engineer to build efficient, data-driven artificial intelligence systems that advance our predictive automation capabilities. The candidate should be highly skilled...
hardware testingmanual testingsoftware testingtesting

Specialist I - SE - React , Typescript
UST Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

Role Overview: As a Lead Software Engineer within our enterprise product domain, you will play a pivotal role as both an expert individual contributor and a technical multiplier. You will be respo...
JavascriptReactJsNodeJs

PREV
NEXT

software measurement Job Openings

Job Title: Store Manager Company: Dabur India Limited leadershipmanagementcommunication skillsmaterial receiptstore managementdispatchwarehouse operationsstock control

Position Overview We are seeking a dynamic and results-driven Inside Sales Manager to join our team. This role is pivotal in driving our sales initiatives and expanding our m... market researchsales strategysales promotionsales administrationsalesmarketing

Job Title: Senior Telesales Executive

Position Overview We are seeking a dynamic and results-driven Senior Telesales Executive to join our growing team. This role is pivotal in driv... software marketingsoftware salestelesalestelemarketingtelecom salestelecalling

Position Overview We are seeking a dynamic and results-driven Inside Sales Manager to join our team. This role is pivotal in driving our sales initiatives and expanding our m... market researchsales strategysales promotionsales administrationsalesmarketing

Job Title: Store Manager Company: Dabur India Limited leadershipmanagementcommunication skillsmaterial receiptstore managementdispatchwarehouse operationsstock control

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Position Overview We are seeking a dynamic and results-driven Inside Sales Manager to join our team. This role is pivotal in driving our sales initiatives and expanding our m...
market researchsales strategysales promotionsales administrationsalesmarketing

Position Overview We are seeking a dynamic and results-driven Senior Telesales Executive to join our growing team. This role is pivotal in driv...
software marketingsoftware salestelesalestelemarketingtelecom salestelecalling

Position Overview We are seeking a dynamic and results-driven Inside Sales Manager to join our team. This role is pivotal in driving our sales initiatives and expanding our m...
market researchsales strategysales promotionsales administrationsalesmarketing