solid understanding jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

solid understanding Job Openings

Showing 26601 - 26650 of 41447 Jobs

Support Engineer

NEW ERA LIFE CARE PRIVATE LIMITED 10.00 to 20.00 Years Chennai,Bangalore, Noida, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City, Delhi 29 Oct, 2024

EBS Apps technical

LTIMindtree Limited 10.00 to 20.00 Years Chennai,Bangalore, Noida, Hyderabad, Pune, Mumbai City, Delhi 29 Oct, 2024

oracle order management

oracle scm

r12

oracle ebs

Housekeeping Supervisor

NEW ERA LIFE CARE PRIVATE LIMITED 19.00 to 22.00 Years Chennai,Bangalore, Noida, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi, Port Blair 29 Oct, 2024

Digital Marketing Manager

Pneumatic Vacuum Elevators and Lifts-India Private Limited 3.00 to 8.00 Years Chennai 29 Oct, 2024

online lead generation

creative writing

creative optimization

All India Sales Manager

Pneumatic Vacuum Elevators and Lifts-India Private Limited 3.00 to 8.00 Years Chennai 29 Oct, 2024

Accounts & Administration Executive

ARYAN TECHNOLOGY 0.00 to 4.00 Years Chennai,Bangalore, Noida, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

Accountant Responsibilities:
- Complying with all company, local, state, and federal accounting and financial regulations.
- C...
  tallyaccountingauditing

EWM Functional Consultant

LTIMindtree Limited 5.00 to 10.00 Years Chennai,Bangalore, Noida, Hyderabad, Kolkata, Mumbai City 29 Oct, 2024

SAP EWM Experience of working with Decen...
saphana

Development Director

NEW ERA LIFE CARE PRIVATE LIMITED 22.00 to 0.00 Years Bangalore,Chennai, Noida, Hyderabad, Kolkata, Gurugram, Pune, Dhubri, Mumbai City, Delhi 29 Oct, 2024

HR Business Partner

NEW ERA LIFE CARE PRIVATE LIMITED 19.00 to 25.00 Years Bangalore,Chennai, Noida, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City, Delhi, Itanagar 29 Oct, 2024

Assistant Manager Finance

MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 6.00 Years Bangalore,Noida, Chennai, Hyderabad, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

Revenue Accounting:

Record and monitor revenue transactions to ensure they are recognized in the correct accounting periods.
Prepare and review journal entri...
advanced exceloperationstds calculationtallypreparationtdsvoucherbillingexcel reportprocurementfinancial reporting

Technical Account Manager

LEADZN PRIVATE LIMITED 6.00 to 11.00 Years Bangalore,Zimbabwe, Mozambique, Afghanistan, Chennai, Noida, Hyderabad, Kolkata, Gurugram, Pune, Mum 29 Oct, 2024

electrical maintenance

construction engineering

Office Assistant

LEADZN PRIVATE LIMITED 6.00 to 11.00 Years Bangalore,Chennai, Noida, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City, Delhi 29 Oct, 2024

What does an office assistant do

front office management

Field Operator

OVERNET TRADING PRIVATE LIMITED 24.00 to 25.00 Years Bangalore,Raipur, Vapi, Hyderabad, Gurugram, Mumbai City, Mahesana, Delhi, Vasco Da Gama, Khagaria 29 Oct, 2024

Field Operator I sets up, operates and troubleshoots a variety of machines and/or equipment on customer site in accordance with established procedures and guidelines. Reads and interprets blu...
marketinglabfielddataentryassistancestoreproductionwelderoperatorcategorymanagerforemanclerkassistant

Regional Marketing Manager
LEADZN PRIVATE LIMITED 10.00 to 20.00 Years Bangalore,Zimbabwe, Mozambique, Afghanistan, Chennai, Noida, Hyderabad, Gurugram, Kolkata, Pune, Mum 29 Oct, 2024

We are looking for a goal-oriented regional marketing manager to implement marketing campaigns in accordance with the regions demographics. In this role, your responsibilities will include foreca...
regional marketingmarketingsales administrationlogistics managementdistribution managementsales coordinationregional managementpublictransportation managementcoordinatormanagerrelationsexecutive

Child Life Specialist
NEW ERA LIFE CARE PRIVATE LIMITED 11.00 to 21.00 Years Bangalore,Chennai, Noida, Nellore, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City, Delhi 29 Oct, 2024

We are looking for a Child Life Specialist to join our team and help our pediatric patients have a more relaxing and effective recovery time while in our healthcare facility. Child Life Speciali...
collaborationleadershipcommunicationadvocacytherapydevelopmentpatienceemotionalservicesfamilylifeempathychildplayengaging

Demand Generation Manager
SAIKOR SECURITY TRAINING AND SERVICES PRIVATE LIMITED 18.00 to 25.00 Years Bangalore,Noida, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi, Port Blair 29 Oct, 2024

We are looking for a Demand Generation Manager to develop and implement strategies to generate leads and revenue for the company. You will be responsible for working closely with the sales and m...
servicetelemarketinginsurancedigitalgoodappointmentsbusinesscrmdevelopmentcommunicationcustomersalesmarketingoutboundgenerationcallslife

Quality Control Manager
OVERNET TRADING PRIVATE LIMITED 24.00 to 25.00 Years Bangalore,Raipur, Vapi, Hyderabad, Gurugram, Mumbai City, Mahesana, Delhi, Vasco Da Gama, Khagaria 29 Oct, 2024

We are looking for a detail-oriented quality control manager to ensure the manufacturing production lines run smoothly and generate a consistently suitable output of products that meet quality an...
salestechgeneralqualityseniorprocurementcontrolequipmentproduction headsupervisoroperatorelectricalinstrumentmanager

Biomedical Technician
LEADZN PRIVATE LIMITED 10.00 to 20.00 Years Bangalore,Zimbabwe, Mozambique, Noida, Chennai, United Arab Emirates, Hyderabad, Kolkata, Gurugram, 29 Oct, 2024

We are looking for a dynamic biomedical technician to join our biomedical department. In this role, youll be in charge of overseeing the care and use of all biomedical equipment, performing machi...
biomedical engineeringhealthcarehealthcare operationsmedical equipment planningclinical engineeringcardiologybiomedicaltechnical processbiomedical electronicsnutritionistanalyst

Assistant Finance Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 3.00 to 7.00 Years Bangalore,Noida, Chennai, Hyderabad, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

Job description

Developing an understanding of the strategies that drive our growth, you will be at the forefront of how we evolve to meet our goals. We have Finance Business Part...
payrollsupply chainprocurementrisk managementcustomer developmentforecastingfinancial reportinganalytical

FRONT OFFICE MANAGER
HAPPY SQUARE OUTSOURCING SERVICES PRIVATE LIMITED 1.00 to 5.00 Years Bangalore 29 Oct, 2024

Job Brief: We are looking for a Front office manager to manage our reception area. You will act as the face of our company and ensure visitors receive a heartwarming welcome. You will also coord...
fom

Project Engineer
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 8.00 Years Bangalore,Chennai, Noida, Hyderabad, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

Prepare, schedule, coordinate, monitor, and control assigned engineering projects to ensure timely completion and quality delivery.

Monitor compliance with applica...
negotiationsite managementcivil engineeringengineeringleadershipsite executionautocadproject managementsite supervision

Marketing Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 9.00 Years Bangalore,Chennai, Noida, Hyderabad, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

Develop and execute marketing strategies to enhance brand awareness and promote real estate projects effectively.

Analyze market trends, competitor activities, and...
product promotionbrand awarenesscommercial marketingcommunication skillsreal estate marketing

Bio-tech Research Associate / Scientist
NEW ERA LIFE CARE PRIVATE LIMITED 2.00 to 7.00 Years Bangalore,Iran, Zimbabwe, Mozambique, Jaipur, Iraq, Chennai, Noida, Hyderabad, Kolkata, Lebanon, Gur 29 Oct, 2024

We are looking for a Biologist to join our team and conduct research and experiments to gain a better understanding about different biological organisms in nature. Biol...
sciencebiochemical engineeringresearch analysisbioprocessingmicrobiologybiochemistryneurostimulationmicrobiological analysisbiologics

Test Automation Architect
UST Global 10.00 to 16.00 Years Bangalore,Chennai, Kochi, Noida, Hyderabad, Pune, Thiruvanananthapuram 29 Oct, 2024

Test Automation Architect Position Overview: We are seeking an experienced Test Automation Architect to design, develop, and maintain robust automation framewo...
pythonquality assurancejavaseleniumtosca

MS dynamics CRM developer - Wipro (PAN India)
Wroots Global Private Limited 7.00 to 12.00 Years Bangalore,Hyderabad, Delhi 29 Oct, 2024

Immediate joiner or 30 days notice period is preferred.

More than 5 years of experience on Dynamics CE/ MS Dynamics CRM

Field service module exp mandate ...
dynamics crmpowerms dynamics crmpluginsappsd365automate

Microsoft Dynamic CRM
Wroots Global Private Limited 6.00 to 11.00 Years Bangalore,Noida, Chennai, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City, Delhi 29 Oct, 2024

Location- PAN India Wipro locations (Bangalore, Hyderabad, Chennai, Gurgaon, Greater Noida, Pune, Kolkata, Mumbai) B3 -6YR EXP- power.netms dynamics crmlead

Salesforce CPQ - Lead (Wipro)
Wroots Global Private Limited 7.00 to 12.00 Years Bangalore,Noida, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

Immediate Joiners or 30 Days Notice period is preferred.

Minimum 5 years of experience in Salesforce Sales & CPQ Cloud or any other CPQ Product salesforcelwccpq

Business Development Manager (Marketing Service Sales )
IMS people possible 2.00 to 6.00 Years Ahmedabad,Other Gujarat 29 Oct, 2024

Excellent Communication Skill Experience : 2 to 4 Years in Marketing Service Sales Market Research and Analysis: Conduct market research to identify potential business opportunities and trends....
Strategic PlanningClient Relationship ManagementNetworkingRisk ManagementSocial Media ManagementHootsuiteContent CreationExcellent Communication SkillMarket ResearchAnalysisSalesRevenue GenerationProposalPresentation DevelopmentNegotiation

Lead Generation
SetuBridge Technolabs 2.00 to 6.00 Years Ahmedabad,Other Gujarat 29 Oct, 2024

SetuBridge Technolabs is looking for a highly skilled and experienced Lead Generation Specialist to join our dynamic team. As a Lead Generation Specialist, you will play a crucial role in identify...
Microsoft Office SuiteSocial Media PlatformsMarketing ConceptsCustomer BehaviorOrganizational SkillsAnalytical MindsetPositive Attitude

Marketing Communications Executive
Triffid Marketing Private Limited 1.00 to 5.00 Years Ahmedabad,Other Gujarat 29 Oct, 2024

About Us: TRIFFID, is a global partner for all things marketing. Headquartered in India and catering to global clients, were not just a marketing agency were a brands growth champions. In a wor...
AdaptabilityExcellent Communication SkillsExperience in MarketingAdvertisingAnalytical Acumen

Property Consultant
079 spaces 0.00 to 4.00 Years Ahmedabad,Other Gujarat 29 Oct, 2024

URGENT OPENINGS FOR PROPERTY CONSULTANT WE ARE HIRING! ROLE DESCRIPTION The property consultant will be responsible for consulting clients, providing exceptional customer service, and driving s...
Customer serviceSalesStrong negotiationProblem solving abilities

React native developer
Techerudite 2.00 to 6.00 Years Ahmedabad,Other Gujarat 29 Oct, 2024

Work as part of a team to build React Native iOS / Android applications for FullStack clients. Build pixel-perfect, responsive UIs across both mobile platforms. Architect, build and maintain exc...
JavaScriptHTMLCSSUnit testingOOPS programmingREST APIs

Golang Developer - Ahmedabad
Vedlogic Solutions Pvt Ltd 3.00 to 7.00 Years Ahmedabad,Other Gujarat 29 Oct, 2024

Degree in Computer Science, Engineering, or a related field as well as prior experience as a Golang Developer You possess strong knowledge of common Goroutine and channel patterns You have exper...
dependency managementGitRESTful APIsdatabase systemstesting toolscommunication skillsGolang DeveloperGoroutineGo frameworksGo templating languagecode generation toolsteam player

Android Developer
GFL Recruitment Private Limited 3.00 to 7.00 Years Ahmedabad,Other Gujarat 29 Oct, 2024

Job Description Mobile Developer with strong Android development experience in Android studio. Requirements And Responsibilities Lead a small team of Android developers to develop our applicati...
Android developmentAndroid StudioRequirement AnalysisDesigningAndroid SDKJAVAAPIsDevelopingAndroid Enterprise applicationKotlinUI designing

Sales Executive ( Solar )
AIMHIGH HUMAN RESOURCES PRIVATE LIMITED 1.00 to 6.00 Years Ahmedabad,Navsari 29 Oct, 2024

Requirement: 1) Good Communication Skills. 2) Understanding about solar and its product. 3) have to travel out of city also....
lead generationsales

Credit Manager Auto Loans
Taggd 2.00 to 7.00 Years Ahmedabad,Indore, Ranchi, Patna 29 Oct, 2024

Hiring Credit Manager and Area Credit Manager in Auto Loans/ Vehicle Loans Domain. All India opening. Locations Ranchi, Indore, Ahmedabad, Guwahati, Andhra Pradesh, Bihar. Duties & Resp...
vehicle loanscredit controlcredit analysiscredit risk

Layout Engineer
Talish Solutions 4.00 to 9.00 Years Ahmedabad 29 Oct, 2024

We have an opening for Layout Engineer our client in Kheda. Layout Engineer (Foundry) Position Title: Layout Engineer layoutfoundrydesigninspectionengineerdrowning

Assistant Manager Supply Chain (Social) for Cotton Industry
IMPACT CONSULTANTS 5.00 to 10.00 Years Ahmedabad,Rajkot, Aurangabad, Pune 29 Oct, 2024

A leading MNC Cotton company ishiring Asst. Manager Supply Chain (Social) Key Accountabilities:

The incumbent will help in implementing social conduc...
supply chaincomplianceginnersoraganic cotton

Billing Analyst
Divya Staffing Solution 0.00 to 4.00 Years Pune,Dehradun, Kolkata, Belgaum, Manali, Vasco Da Gama, Dibrugarh, Ahmedabad, Shimla, Guwahati 24 Oct, 2024

The billing analysts responsibilities include coordinating with other departments to ensure all sales and orders are accurately billed for, setting clients up for billing, issuing invoice Billin...
billinghealthcarepatient assessmentpatient care

Director of sales
TRAAB ENGINEERING INDIA PRIVATE LIMITED 15.00 to 25.00 Years Pune,Bangalore, Noida, Nellore, Vijayawada, Hyderabad, Kolkata, Gurugram, Mumbai City, Delhi 24 Oct, 2024

We arelooking forahigh-performing Sales Director. The successful candidate will meet our customer acquisition and revenue growth objectives. Sales director responsibilities include developing ke...
processcustomermanagementrevenuesalesbusinessdevelopmentplanaccountstrategiessatisfactiongrowth

Sale Representative
Dhitech Consultancy Services 5.00 to 10.00 Years Pune,Other Maharashtra, Bangalore, Chennai, Hyderabad, Mumbai City, Delhi, Qatar 24 Oct, 2024

URGENT REQUIREMENT FOR QATAR FINAL CLIENT INTERVIEW NEXT WEEK IN MUMBAI POSITION :-Sale Representative Job Description/Profile Descri...
quotationnegotiationclient relationship managementcustomer servicesales generation

Loan Review-Lead Analyst (SME)
locus enterprises 8.00 to 13.00 Years Pune,Bangalore, Chennai, Gurugram, Mumbai City 24 Oct, 2024

SME Loan Review

8 years of experience in loan review of commercial credit (mandatory CRE, and C&I) with good understanding of risk policies and framework,...
crecommercial credit

Data Engineer
IQuest Management Consultants Pvt Ltd 6.00 to 9.00 Years Pune,Bangalore 24 Oct, 2024

Hi, We have an urgent opening for the vacancy of Data Engineer. Location - Bangalore & Pune Mandatory Skills- SQL , Python, Data Lake Roles and Responsibilities: Manage multiple ML projects ...
datalakesql

Drilling Supervisor
P Tanyu Konyak Hiring For P Tanyu Konyak 7.00 to 12.00 Years Pune,Bangalore, Chennai, Noida, Hyderabad, Kolkata, Gurugram, Mumbai City, Delhi, Port Blair 24 Oct, 2024

We are looking for a highly skilled and experienced Drilling Supervisor to join our team. The ideal candidate will be responsible for overseeing all aspects of drilling operations, ensuring that...
horizontal directional drillingdrilling machinedrilling engineeringdirectional drillingdrilling

Vb.net Developer
Acura Solutions 5.00 to 8.00 Years Pune,Bangalore, Chennai, Noida, Hyderabad, Kolkata, Gurugram, Mumbai City, Delhi 24 Oct, 2024

We are seeking a skilled VB.NET / C# and SQL Server Developer with a minimum of 5 years of hands-on experience. The ideal candidate must have strong expertise in VB.NET, along with solid experien...
.net frameworkt-sqlvb.netsql

Design Engineer - Power Electronics
SYGNIFIC SERVICES 3.00 to 5.00 Years Pune 24 Oct, 2024

We have an urgent opening for Design Engineer - Power Electronics role for Bhosari, Pune location who can able to join within 30 days. JOB DESCRIPTION:-...
battery chargercircuit designsystem designpower electronics

Data Engineer
LTIMindtree Limited 12.00 to 18.00 Years Pune,Bangalore, Kolkata, Mumbai City, Delhi 24 Oct, 2024

Job Title: Data Engineer Location: All LTIM Office Locations Experience: 12-16 Years Position Overview: We are seeking a Data...
cloudpythonawsdatabasesparkdata engineer

Hiring For Instrumentation Designer
BHA FOODS PRIVATE LIMITED 7.00 to 12.00 Years Pune,Other Maharashtra, Thane, Bangalore, Chennai, Other Tamil Nadu, Hyderabad, Pondicherry, Other P 24 Oct, 2024

Job description Role & responsibilities BASIC PURPOSE: To produce error and clash free model and detailed drawings according to standard/project ...
mechanism designbuilding bridgesinstrumentationdesign engineeringbridge inspectionroad managementhighway constructionhighway engineeringroad maintenancehiringroad constructionfor

Chemical Analyst
NEW ERA LIFE CARE PRIVATE LIMITED 1.00 to 6.00 Years Pune,Congo, Niger, Mauritius, Bangalore, Noida, Chennai, Hyderabad, Gurugram, Kolkata, Ivory Coast, 24 Oct, 2024

A Chemical Analyst is responsible for carrying out scientific tests and experiments on chemical substances to determine their composition, properties, and behaviour. They analyse data and prepare...
communicationtroubleshootinganalyticalchemicalqualityproblemchromatographymethodscontrolsamplinganalysissolvingskills

Quality assurance inspection
SAIKOR SECURITY TRAINING AND SERVICES PRIVATE LIMITED 20.00 to 25.00 Years Pune,Bangalore, Chennai, Noida, Hyderabad, Kolkata, Gurugram, Mumbai City, Delhi, Port Blair 24 Oct, 2024

We are looking for a reliable Manager of Quality Assuranceto ensure that all external and internal requirements are met before our product reaches our customers. You will be resp...
isosafetyparticleinspectionqualitystandardsprocedurescalipersproductsmicrometersresults

PREV
NEXT

solid understanding Job Openings

Accountant Responsibilities:

What does an office assistant do

Job description Developing an understanding of the strategies that drive our growth, you will be at the forefront of how we evolve to meet our goals. We have Finance Business Part... payrollsupply chainprocurementrisk managementcustomer developmentforecastingfinancial reportinganalytical

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Job description

Developing an understanding of the strategies that drive our growth, you will be at the forefront of how we evolve to meet our goals. We have Finance Business Part...
payrollsupply chainprocurementrisk managementcustomer developmentforecastingfinancial reportinganalytical