technical profiles jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

technical profiles Job Openings

Showing 8901 - 8950 of 38515 Jobs

Adobe Analytics(dashboardSQL)

LTIMindtree Limited Fresher Chennai 25 Sep, 2025

Job Description

Adobe AnalyticsCampaign

Assistant Manager FMCG Company

sk online services Fresher Ahmedabad, GujaratGujarat, Baddi, Bangalore, Andhra Pradesh, Kullu, Dharamshala, Dalhousie, Bilaspur 25 Sep, 2025

Job description In case of any query, kindly connect on78,34,98,21,39 Rita Preference will be given to immediate joiners. We are looking for a skilled Assistant Manager t...
management skillsproduct trainingproject planningcustomer serviceinventoryteam leadingcommunication skillsproduct qualityleadership

Electrical Engineer & Mechanical Engineer

A-ONE STAFFING Fresher Ahmedabad, SuratSurat, Lucknow, Mumbai City, Delhi 25 Sep, 2025

Requirement Available

Post - Electrical Engineer, Mechanical Engineer

Required Experience - 1 yr to 3yr

Salary - 20,000 t...
power plantindustrialsitesite engineeringsite managementelectrical engineeringmachine designmechanical maintenanceelectrical designmechanical engineering

Opportunity International Chat Support Onsite Role in Hyderabad

ARTECH INFOSYSTEMS PRIVATE LIMITED Fresher Vijayawada, KakinadaKakinada, Kurnool, Andhra Pradesh, Hyderabad 24 Sep, 2025

International Chat Suppor...
technical supportinternational call centerinternational bpocustomer supportvoicechatesupportchat process

Quality Control Coordinator
ASSETCARE SERVICES PRIVATE LIMITED Fresher Vishakhapatnam, HyderabadHyderabad, Kadapa, Purnia, Bangalore, Chennai, Kolkata, Gurugram, Chandigar 24 Sep, 2025

A Quality Control (QC) Coordinatorensures products and services meet company and industry standards by performing inspections, tests, and data analysis, resolving issues, and ...
technicalskillsorganizationalexperienceproblem-solvingproficiencydetail

Service Engineer
CONCEPTS GLOBAL Fresher Vadodara, JaipurJaipur, Bangalore, Mumbai City 24 Sep, 2025

Position Overview We are seeking a dedicated and skilled Service Engineer to join our dynamic team. This role is essential in ensuring the optimal performance of our electron...
electronicslaminationphotocopiershreddersinstallation

Sr. Manager - FRD Non-Orals
SUN PHARMA Fresher Vadodara, Gujarat 24 Sep, 2025

As a seasoned professional in the field of pharmaceutical sciences, you will be responsible for providing technical expertise, strategic leadership, project management, regulatory compliance, and ...
process optimizationcharacterizationregulatory requirementscommercializationRegulatory AffairsQuality AssuranceManufacturingMarketingtechnology transfercGMPGLPteam developmentproject managementleadershipcommunicationformulation designlipos

PHP & WordPress Developer
SEOWebPlanet Solutions - Digital Marketing Company in India Fresher Vadodara, Gujarat 24 Sep, 2025

As a WordPress Developer, you will be responsible for developing websites on WordPress based on the provided design with meticulous attention to detail. You will collaborate closely with the desig...
WordPressPSDHTMLHTML5CSS3JavaScriptPHPDebugging ToolsFigmaWordPress ThemingACF ProElementor

Bulk Hiring for Freshers 12th Pass
SHRI BALAJI ENTERPRISES Fresher Vadodara, SuratSurat, Ahmedabad, Bangalore, Indore, Chennai, Hyderabad, Vishakhapatnam, Pune, Mumbai 24 Sep, 2025

Job Summary
We are looking for enthusiastic and customer-focused individuals to join our BPO team as Call Cen...
negotiation skillsprocesstechnical supportbusinesscustomer serviceadaptabilityteamworkoutsourcingbpotime managementcall handlingmultitasking

Web Content Writer
Tempsens Instruments (I) Pvt Ltd Fresher Udaipur, Rajasthan 24 Sep, 2025

As a Technical Content Writer at Tempsens located in Udaipur, Raj, you will play a crucial role in creating high-quality content for the companys website, blogs, and marketing materials. Your prim...
Keyword researchGoogle AnalyticsWritten communicationVerbal communicationSEOoptimized technical content writingContent marketing strategiesContent management systems CMS

Lead Engineer
SPENTO PAPERS (INDIA) LLP Fresher Udaipur, JaipurJaipur, Czech Republic, Ethiopia, Dominica, Agra, Dibrugarh, Varanasi, Kuwait, Rampur 24 Sep, 2025

Design Leadership & Management:

Lead and manage a team of engineers and designers within the [relevant discipline] to develop detailed designs for offsho...
offshore platformsoiloffshore oillifting operationsgaswell controllifting equipmentoffshore constructionunderbalanced drillingonshore operations

Recruiter / Junior Recruiter BFSI Recruitment
Team Ace HR LLP Fresher Mumbai City 24 Sep, 2025

Job Title: Recruiter / Junior Recruiter BFSI Recruitment Location: Goregaon West, Mumbai (2 minutes wa...
recruitmentsourcingtalent acquisitionbfsi recruitmentscreening resumes

HR Recruitment Manager - Manufacturing
YO IT CONSULTING Fresher Surat, Gujarat 24 Sep, 2025

As an HR Analyst located in Surat with 5 to 10 years of experience, you must have a background in recruitment, HR, or talent acquisition roles, with a specific focus on hiring for manufacturing or...
adaptabilitymanufacturingscreeningprocess designhuman resource developmentprocess improvementonboardingstakeholder managementhiringrecruitmentinterviewingmanagementdata analysissourcingtalent acquisitioncommunicationelectronicssourcing

Urgent requirement for Production Supervisor
sk online services Fresher Bhubaneswar, NashikNashik, Maharashtra, Odisha, Hyderabad, Nanded, Navi Mumbai, Thane, Ahmednagar, P 24 Sep, 2025

Company: Dabur India Limited Department: Production / Maintenance / Safety (based on posting) Location: In Your State Job Responsibil...
production managementproduction controlproductionproduction operationstestingmaterial handlingproduction planningteam leading

Hiring For Business Analyst
DEVIKA STAFFING SOLUTION Fresher Bhubaneswar, CuttackCuttack, Oman, Qatar, Patna, Kuwait, Darbhanga, United Arab Emirates, Raipur, Ve 24 Sep, 2025

We are seeking a skilled and detail-oriented Business Analyst to join our team. The Business Analyst will be responsible for analyzing business processes, identifying areas for improvement, and d...
consultingsapanalyticsbusiness development

Administrative Operations Manager
ATOVITT SERVICES PRIVATE LIMITED Fresher Rajkot, AhmedabadAhmedabad, Bangalore, Chennai, Noida, Hyderabad, Kolkata, Gurugram, Pune, Patna 24 Sep, 2025

Our company is looking for an administrative operations manager. Please review the list of responsibilities and qualifications. While this is our ideal list, we will consider candidates that do no...
continuous improvementadministrative assistancestrategic planningrisk managementtechnical proficiencyproject managementadministrative functionsskills management

Urgent requirement for Production Supervisor
sk online services Fresher Bhubaneswar, NashikNashik, Maharashtra, Odisha, Hyderabad, Nanded, Navi Mumbai, Thane, Ahmednagar, P 24 Sep, 2025

Company: Dabur India Limited Department: Production / Maintenance / Safety (based on posting) Location: In Your State Job Responsibil...
production managementproduction controlproductionproduction operationstestingmaterial handlingproduction planningteam leading

.NET Developer
FinJo Fresher Khordha 24 Sep, 2025

You are an accomplished .NET Developer with over 4 years of professional experience, responsible for designing, developing, and maintaining enterprise web applications at client project sites. You...
SQL ServerOOPSOLID principlesJavaScriptjQueryHTML5CSS3AzureAWSGitAgile methodologyNET CoreNET FrameworkASPNET MVCWeb APIEntity FrameworkEF CoreRESTful services

Hiring For Business Analyst
DEVIKA STAFFING SOLUTION Fresher Bhubaneswar, CuttackCuttack, Oman, Qatar, Patna, Kuwait, Darbhanga, United Arab Emirates, Raipur, Ve 24 Sep, 2025

We are seeking a skilled and detail-oriented Business Analyst to join our team. The Business Analyst will be responsible for analyzing business processes, identifying areas for improvement, and d...
consultingsapanalyticsbusiness development

Sales Executive- Computer Showroom
Tanisha E- World Fresher Bhubaneswar 24 Sep, 2025

As a Sales Executive at Tanisha E-World, you will be a vital part of our team, specializing in high-performance PCs, laptops, gaming systems, and IT accessories. With a strong commitment to qualit...
SalesComputer HardwareCustomer ServiceRelationship BuildingPeripheralsCustomer ConsultationTechnical KnowledgeGaming SystemsSales TargetsComputer Components

presales consultant
BSH TECHNOLOGIES PRIVATE LIMITED Fresher Bhubaneswar 24 Sep, 2025

Work closely with the Business Development & Sales teams to support lead qualification and opportunity conversion.

Conduct r...
crmpresentationsclientsmbsoftwaresalestoolsexcelpowerpointdemosmarketproposalsstrongmandatory.knowledgesystems.serviceslikeestimationsusing

Workfront Specialist Opportunity at Capgemini - PAN India location
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Bhubaneswar, BangaloreBangalore, Noida, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, De 24 Sep, 2025

We are currently looking for a professional with strong experience in Workfront Development to join one of our clients. Please find below the key responsibilities and skill requirements for this ...
fusiondevelopment

Area Sales Manager (ASM)
ANYTHING SKOOL LIMITED Fresher Ranchi, Jharkhand 24 Sep, 2025

You will be joining as an Area Sales Manager with 4-7 years of experience in the Education Industry, focusing on School Marketing. Your educational qualifications should include an MBA in Marketin...
MarketingSchool MarketingCommunication SkillsPresentation SkillsAnalytical SkillsTeam HandlingMarket Study

Urgent Hiring Civil Site Engineer Fresher
Classic Enterprises Fresher Ranchi, GayaGaya, Hyderabad, Lucknow, Gurugram, Kolkata, Pune, Surat, Guwahati, Ahmedabad 24 Sep, 2025

Job Description Dear Job Seekers, Greetings of the day. We are recruiting for Civil Engineer Fresher can apply. only interested candidate send your resume or call to contact person. We have *...
autocadmonitoringconstructionsite engineeringms officecompliance monitoringcivil construction

Hiring For Chemical Engineer
DEVIKA STAFFING SOLUTION Fresher Raipur, BhopalBhopal, Dehradun, Indore, Navi Mumbai, Pimpri Chinchwad, Thane, Pune, Haridwar, Guwaha 24 Sep, 2025

We are looking for a creative, cooperative chemical engineer with a wealth of technical and industry knowledge and a talent for process optimization. The chemical engineer will work in the office...
productionmaintenanceresearchquality

Product Manager for Dust Collection System
Spark & Ray Technocrats Private Limited Fresher Raipur 24 Sep, 2025

As a highly motivated and technically proficient Mechanical or Instrumentation Engineer, you are being sought for the role of Product Manager focusing on Dust Collection Systems with specializatio...
Mechanical EngineeringInstrumentation EngineeringProduct ManagementDust Collection SystemsSolenoid ValvesCylindersTechnical SalesLead QualificationBag FiltersPulse Jet ValvesPurging ValvesPneumatic ProductsFRLsTubesFittings

Sales Engineer
MAS INDUSTRIES PVT LTD Fresher Raipur 24 Sep, 2025

Identify and generate leads through market visits, networking, and referrals.

Understand customer needs and ...
sales executive activitiesfield engineeringtechnical sales

Hiring For Business Analyst
DEVIKA STAFFING SOLUTION Fresher Patna, RanchiRanchi, Darbhanga, Oman, Qatar, Bhubaneswar, Kuwait, Cuttack, United Arab Emirates, Rai 24 Sep, 2025

We are seeking a skilled and detail-oriented Business Analyst to join our team. The Business Analyst will be responsible for analyzing business processes, identifying areas for improvement, and d...
consultingsapanalyticsbusiness development

Assistant Sales Manager
Talent Leads HR Solutions Pvt Ltd Fresher Patna, RanchiRanchi, Bhubaneswar, Lucknow, Chandigarh, Bhopal 24 Sep, 2025

Job Description Description: Asst. Sales Manager Corporate and Private Sales Department: Sales && Business Development Experience Required: 5-6 years (Relevant Ex...
b2b saleschannel sales

Dot Net Developer
RAJKAMAL BARSCAN SYSTEMS PVT LTD Fresher Patna, KolkataKolkata, Bangalore, Chennai, Noida, Hyderabad, Gurugram, Pune, Mumbai City, Delhi 24 Sep, 2025

Software Developer (.NET|.NET Core) Experience: 2 Years Location: Andheri East, Mumbai and Remote ________________________________________ Key Skills

Technologies:...
mvc frameworkdesignproceduresdatabaseweb applications.net coremssqlstoredentity framework / ef corewindows applicationscustomer support / technical issue resolution.net developer

Data Science Trainee / Junior Data Scientist
Bloom Infotech Fresher Punjab 24 Sep, 2025

As a Data Science fresher, you will be part of our team where you will have the opportunity to apply your analytical and problem-solving skills on real-world datasets. You will collaborate closely...
PythonNumPySQLData VisualizationStatisticsProbabilityPandasScikitlearn

Magento 2 Developer
Sookshum Labs Technologies Private Limited Fresher Punjab 24 Sep, 2025

As a Magento Developer at Sookshum Labs, your primary responsibility will be to develop, customize, and maintain Magento 2-based websites. You will collaborate closely with a team of developers to...
HTMLCSSJavaScriptAPIsjQueryPHPRESTSOAPUI DesignAWSGCPCommunication SkillsMagento Best PracticesRelational Database SystemsObjectOriented ProgrammingProblemSolvingOrganizational SkillsGIT Version Control

Anaesthesia Technician
ALTSEO PRIVATE LIMITED Fresher Mysore, BhubaneswarBhubaneswar, Ernakulam, Tiruchengode, Rudrapur, Navi Mumbai, Fatehgarh Sahib, Kat 24 Sep, 2025

An anesthesia technician assists anesthesiologists and other medical staff in preparing, maintaining, and monitoring equipment and supplies for anesthesia procedures. They play a crucial role in ...
medical terminologycardiopulmonary resuscitationpatient monitoringmedication administrationtechnical proficiencyemergency procedurespost-operative caresterilization techniquessterilization expertise

Purchase & Store Executive
SEQRONICS (INDIA) PRIVATE LIMITED Fresher Mysore 24 Sep, 2025

Position:Purchase Executive / Procurement Officer Experience:Minimum1 years Education:Diploma/BE in Electricals & Electronics...
dispatch planningpurchase management

Solar PV Installation & Maintenance Trainer
DIDYU TECHNOLOGIES PRIVATE LIMITED Fresher Madurai, TiruchirappalliTiruchirappalli, Thanjavur, Erode, Coimbatore, Chennai, Salem, Sivakasi, Kri 24 Sep, 2025

Job Title: Solar PV Installation & Maintenance Trainer Location: Chennai solar pvstandardsmaintenanceinstallationprotocolssafetysolarsolar project field experience

Workforce Services Senior Analyst (Capacity Planning)
Albireo Recruiters Hiring For Accenture Fresher Kakinada, GunturGuntur, Hyderabad, Kurnool, Nellore, Chittoor, Guntakal, Anantpur, Bangalore, Chenna 24 Sep, 2025

Role Workforce Services Senior Analyst (Capacity Planning) Responsible for developing and managing accurate mid to short-term Capacity planning models. These forecasts inform staffing, budgeting...
cross functional coordinationcapacity managementms excelshrinkage controlworkforce managementcontact centeroccupancy planningsla managementaht

Hiring For Mining Engineer
DEVIKA STAFFING SOLUTION Fresher Kochi, KeralaKerala, Assam, Tamil Nadu, Bokaro, Dhanbad, Andhra Pradesh, Jharkhand, West Bengal, Him 24 Sep, 2025

Our company is growing rapidly and is searching for experienced candidates for the position of mining engineer. We appreciate you taking the time to review the list of qualifications and to apply...
miningmaintenancesupervisionquality

Workforce Services Senior Analyst (Capacity Planning)
Albireo Recruiters Hiring For Accenture Fresher Kakinada, GunturGuntur, Hyderabad, Kurnool, Nellore, Chittoor, Guntakal, Anantpur, Bangalore, Chenna 24 Sep, 2025

Role Workforce Services Senior Analyst (Capacity Planning) Responsible for developing and managing accurate mid to short-term Capacity planning models. These forecasts inform staffing, budgeting...
cross functional coordinationcapacity managementms excelshrinkage controlworkforce managementcontact centeroccupancy planningsla managementaht

Executive assistance
ASSETCARE SERVICES PRIVATE LIMITED Fresher Kakinada, HyderabadHyderabad, Ongole, Kadapa, Chittoor, Bangalore, Chennai, Gurugram, Kolkata, Delhi 24 Sep, 2025

An executive assistantprovides high-level administrative support to senior management by managing schedules, coordinating meetings, handling communications, preparing reports,...
communicationtechnicaldetailexperienceattentionproficiencyproblem-solvingorganizational

Opportunity International Chat Support Onsite Role in Hyderabad
ARTECH INFOSYSTEMS PRIVATE LIMITED Fresher Kakinada, HyderabadHyderabad, Kurnool, Vijayawada, Andhra Pradesh 24 Sep, 2025

I hope youre doing well! We came across your profile and were impressed by your experience in customer support. Were currently hiring for an exciting role as an International Chat Suppor...
technical supportinternational call centerinternational bpocustomer supportvoicechatesupportchat process

Software Developer (Full Stack)
EY Fresher Kochi, Kerala 24 Sep, 2025

Role Overview: At EY, youll have the opportunity to build a unique career with global scale, support, inclusive culture, and technology to help you become the best version of yourself. Your unique...
SQLMicrosoft AzureAngularETL technologyMicrosoft Azure Data ServicesAzure Data FactoryDatabricksAzure Data Lake StoreDatabase conceptsData LakeWeb APIPowerBIPowerAppsPowerAutomatePMI

Hiring For Mining Engineer
DEVIKA STAFFING SOLUTION Fresher Kochi, KeralaKerala, Assam, Tamil Nadu, Bokaro, Dhanbad, Andhra Pradesh, Jharkhand, West Bengal, Him 24 Sep, 2025

Our company is growing rapidly and is searching for experienced candidates for the position of mining engineer. We appreciate you taking the time to review the list of qualifications and to apply...
miningmaintenancesupervisionquality

Junior Angular Developer
HighQ-Labs Pvt Ltd Fresher Kochi, Kerala 24 Sep, 2025

You will be responsible for developing and maintaining code in accordance with predefined cost, company, and security standards. Your role will involve working on bug fixes, supporting the mainten...
rest apiSQLMongoDBsoftware programmingHTMLCSSAngular 2Hibernate Java

Delivery Manager
SHARMA ENTERPRISES Fresher Kochi, ThrissurThrissur, Kollam, Ernakulam, Idukki, Kozhikode, Palakkad, Thiruvanananthapuram, Wayan 24 Sep, 2025

We are looking for delivery manager oversees the planning, execution, and successful delivery of a project or product, ensuring it meets timelines, budget, and quality standards. They act as a ce...
team managementproblem solvingproject executionstakeholder managementrisk managementproject planningquality assurance

SEO Specialist
Law Prep Tutorial Fresher Jodhpur, Rajasthan 24 Sep, 2025

You should have 2 to 6 years of experience to apply for the role of SEO Specialist at Law Prep Tutorial. As an SEO Specialist, you will be responsible for leading and implementing organic growth s...
SEOAnalytical skillsEdtechContentled SEOTechnical SEOOnpage implementationSearch intentContent hierarchySEO content frameworksSEO tools

Application Sales Jodhpur (IVD)
ACCUREX BIOMEDICAL PRIVATE LIMITED Fresher Jodhpur, Rajasthan 24 Sep, 2025

As an Application Sales Specialist at Accurex Biomedical in Jodhpur, you will be responsible for providing clinical application support and driving sales in the IVD domain. Your role will involve...
Application SupportSalesMarket IntelligenceDiagnostic InstrumentsCustomer Queries

Production Manager
YOUTAG INFOTECH PRIVATE LIMITED Fresher Jodhpur, JaisalmerJaisalmer, Bhiwadi, Navi Mumbai, Bankura, Uttar Dinajpur, Thane, Mumbai City, Daks 24 Sep, 2025

We are looking for an experienced Production Manager to organize and oversee the manufacturing of goods. You will be ultimately responsible for the smooth running of all production lines and the ...
prosperitypressure transient analysismbalproduction managementproduction engineeringtechnical productionnodal analysis

Assistant Sales Manager
Talent Leads HR Solutions Pvt Ltd Fresher Ranchi, PatnaPatna, Bhubaneswar, Lucknow, Chandigarh, Bhopal 24 Sep, 2025

Job Description Description: Asst. Sales Manager Corporate and Private Sales Department: Sales && Business Development Experience Required: 5-6 years (Relevant Ex...
b2b saleschannel sales

Hiring For Business Analyst
DEVIKA STAFFING SOLUTION Fresher Ranchi, PatnaPatna, Oman, Qatar, Kuwait, United Arab Emirates, Bhubaneswar, Cuttack, Darbhanga, Raip 24 Sep, 2025

We are seeking a skilled and detail-oriented Business Analyst to join our team. The Business Analyst will be responsible for analyzing business processes, identifying areas for improvement, and d...
consultingsapanalyticsbusiness development

Hiring For Mechanical Engineer
DEVIKA STAFFING SOLUTION Fresher Bokaro, DhanbadDhanbad, Ranchi, Odisha, Bhubaneswar, Nashik, Cuttack, Indore, Bhillai, Nagpur 24 Sep, 2025

You will be critical in planning, coordinating and executing mechanical projects, ensuring they meet technical specifications, budgets and established quality standards. You would also collaborat...
qualityproductionsupervision

PREV
NEXT

technical profiles Job Openings

Position Overview We are seeking a dedicated and skilled Service Engineer to join our dynamic team. This role is essential in ensuring the optimal performance of our electron... electronicslaminationphotocopiershreddersinstallation

Job Summary

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Position Overview We are seeking a dedicated and skilled Service Engineer to join our dynamic team. This role is essential in ensuring the optimal performance of our electron...
electronicslaminationphotocopiershreddersinstallation