Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Testing plays a significant role in development of new software and systems.Testing Engineers work closely with software developers and program managers to iron out any bugs in the product , and impro...
javascript sql java it jquery risk estcases testenvironments analyticalskills versionmanagement softwaredevelopmentlifecycle programmanagers sqlserver softwaredevelopment lifecycle projectadministrationRoles and responsibilities Designation: Software Tester- ManualDesired experience: 1. 6 4 years in testing. Qualification: BE/ B Tech/ M Tech/ MCA and equivalent. Salary: NegotiableJob locat...
regressiontesting functionaltesting manualtesting testcases webservices problemsolving databasetesting sql net ep ting sqlqueries useracceptance testenvironments projectadministration tests manual tePerformance Test Lead - Job Description Qualification: B.E / B.Tech , M.E / M.Tech , MCA from a reputed University Understand the application architecture and business domain Proficient and hands ...
mysql oracle sql design html loadrunner uildingperformance problemsolving testenvironments loadrunner performancetesting applicationarchitecture webapplications testscripts sqlserverSDET Engineer Trimble Cloud Platform Chennai, Tamil Nadu, India Trimble is recruiting for a Senior Quality Engineer to fill an opportunity in Chennai, India. Trimble is building its next-generatio...
whiteboxtesting whitebox helpfiles opensource testsuites dataanalytics toolselection versioncontrol automationtools selectionprocess commercialmodels testenvironments automationtesting serdocumeQubole, the leading cloud-agnostic, big data-as-a-service provider, is passionate about making data-driven insights easily accessible to anyone. Qubole delivers the industry s first autonomous data pl...
java linux cisco environment winningothersover strongcommunicationskills bigdata testcases testcoverage dataprocessing problemsolving defecttracking automationtools testenvironments ommunicationskiResponsibilities: Defines software objectives by analyzing user requirements; envisioning system features and functionality. Completes applications development by coordinating requirements, schedu...
jquery sql java javascript serrequirements frontend versioncontrol databasearchitecture springsecurity javaee searchengines testenvironments networksystems lifecycle prof sqlserver computerscienceSenior Software Engineer - Liferay Responsibilities: Co-ordinate development with offshore and clients team Deliver expert, hands-on technical support for urgent troubleshooting Communicate with...
sqlserver java sql customerrelations javascript msofficesuite msoffice frontend springmvc problemsolving computerscience externalclients testenvironments pe tatementsofw ksow technicalsupp
-Responsible to follow a documented test plan and be responsible for the reporting of clear and very detailed bug reports.
-ensure quality testing and bug reporting is maintained throughout t...
Job Purpose The Technical Support Engineer will provide and in- depth level of technical support to our customer base and various departments within Avalara for specified software and SaaS products....
troubleshooting lan operatingsystems salestax knowledgebase technicalskills databasequeries criticalthinking testenvironments productmanagement etw king technicalsupp customersupp productdevelopmenJob Details Job Details Automation Testing Job Description PRIVATE & CONFIDENTIAL Job Description - Automation Tester Postman , Newman , Selenium , Protractor , VSTS Selection and use of approp...
testcasecreation analyticalskills testenvironments functionaltesting softwarearchitecture mis risk manual testing selenium software database reporting readiness automation analytical protractor regression rchitecturShort Description Performance Test Analyst 4 to 6 Years Pune Qualifications Job Responsibilities Performance testing experience with Loadrunner and/or Performance Center Knowledge of HTTP/HTML, Web ...
loadrunner environment testscripts http webservices testanalysis problemsolving developertools businessprocess monit testenvironments communicationskills tests erf mancetesting ingtoolsDERIVE MS | job1 Role: Performance Test Architect Location: Mumbai Prabavathi / Client place Experience Level: 6+ Preferred Qualification: Any Technical Graduate Number of openings: 1 Mandatory ...
java agile automation customerrelations databaseadministration loadrunner opensource testscripts testenvironments communicationskills softwareengineering testing scripts context software erf mancetestingUrgent opening for Software Tester Full Time Posted 5 hours agoPosition : Software Tester Exp : 0 1 yr Responsibilities and Duties : To create and run test cases based on the input provided by t...
regressiontesting functionaltesting manualtesting testcases liveproduction softwaretesting testenvironments it set testing software BlackBoxTesting TestExecution DefectTracking TestEstimation ep tingPerformance Test Lead - Job Description Qualification: B.E / B.Tech , M.E / M.Tech , MCA from a reputed University Understand the application architecture and business domain Proficient and hands ...
mysql oracle sql design html loadrunner uildingperformance problemsolving testenvironments loadrunner performancetesting applicationarchitecture webapplications testscripts sqlserverStrong hands on Experience in Manual and Automated testing Support delivery process by continuous improvement through software test, verification, validation metrics and ensure consistent visibility ...
functionaltesting automation testcases testdata blackboxtesting softwarequalityassurance whitebox blackbox testscripts qualityassurance ep ting softwarequality testenvironments designdevelopmentUniversity degree in a science related subject or in engineering 4-6 years of experience on Manual testing. Knowledge on writing Gherkin scripts. Fluent in English - speaking, reading, writing Des...
testdata datacollection automationtools manual testing writing english science automation documentation TestEnvironments TestRequirements TestCoverage TestEnvironmentSetup DataMasking TestMetrics TestScenarios TestDesigning TestSpecificaDesign and executive test plans and test cases on computer applications. Select and develop appropriate test automation tools, applying the latest techniques in test automation; e.g., data- driven te...
testautomationtools webpages testcases testsuites webstandards dataintegrity versioncontrol testautomation automationtools testenvironments applicationsecurity softwarerequirements onfigurationmanagResponsibilities
Main focus areas Plan & provision application instances environments used on projects within the platform across all lines of business (distribution channels) Analyse the key environment hotspots an...
dataloading changecontrol datamanagement batchprocessing changemanagement testenvironments projectmanagement environmentmanagement configurationmanagement testing onfunctionaltesting
Role Summary: Primary responsibility is to ensure automation testing of the product using Selenium and other automation tool. Apart from that, resource should be able to manage a...
jira testcases agile environment reporting usecases testanalysis testautomation softwaretesting agiledevelopment testenvironments automationtesting problemresolution communicationskills unctionalspecificMusikaar is seeking an engineer to join its highly skilled engineering team. The job involves creating functional test cases, executing test cases, setting up various configurations required for testi...
testcases automation jira testscripts codecoverage manualtesting communicationskills ramew rep ting itemresponsethe windowsos bugtracking remotetesting testenvironments netw kingproducts verbMusikaar is seeking an engineer to join its highly skilled engineering team. The job involves creating functional test cases, executing test cases, setting up various configurations required for testi...
testcases automation jira testscripts codecoverage manualtesting communicationskills ramew rep ting itemresponsethe windowsos bugtracking remotetesting testenvironments netw kingproducts verbSDET Engineer Trimble Cloud Platform Chennai, Tamil Nadu, India Trimble is recruiting for a Senior Quality Engineer to fill an opportunity in Chennai, India. Trimble is building its next-generatio...
whiteboxtesting whitebox helpfiles opensource testsuites dataanalytics toolselection versioncontrol automationtools selectionprocess commercialmodels testenvironments automationtesting serdocumeTesting (Ahmedabad - Gujarat, India) Testing (Ahmedabad - Gujarat, India) Quality Analyst : Experience : 1 Years+ - Good understanding of testing methodologies and concepts. - Should have experience i...
testcases testplanning manualtesting testscenarios defecttracking qualityanalysis testenvironments qa ui uat manual testing writing software business planning analysis protocol adherence nf mationflowRole is to provide innovative test automation system for the organization with respect to functionality, performance, scalability and other quality goals Were always happy to assist you! Automation ...
automation selenium java testng amazonwebservices environmentalimpactassessment webservices riskassessment riskmitigation testautomation webapplications operatingsystems testenvironments ramew automatioUrgent Opening for TDM-Test Data Management+Oracle/SAP/ERP Location: Pune Exp: 4 to 5.11 Yrs B2 Pune Joining . 15/20 Days joiner.
Technical activities Produce all required test documentation to Travelex standards Produce test specification documentation for all phases of the test life cycle including test plans test conditions t...
testdata testcases testscripts ts testspecification writing scripts documentation TestEnvironments TestRequirements TestCoverage TestEnvironmentSetup DataMasking ummaryrep perf mancePerformance Test Lead - Job Description Qualification: B.E / B.Tech , M.E / M.Tech , MCA from a reputed University Understand the application architecture and business domain Proficient and hands ...
mysql oracle sql design html loadrunner uildingperformance problemsolving testenvironments loadrunner performancetesting applicationarchitecture webapplications testscripts sqlserverBuild Environment Manager Location : Pune Number of Positions : 1 Experience : 6-9
Need is for Build and Environment manager for managing on-premises Development E...
testdata issuemanagement managementsystem testenvironments applicationsoftware it vm design testing windows software patching snapshot management operations cleinstallation supp tdocumentation acle teamcenDesign and executive test plans and test cases on computer applications. Select and develop appropriate test automation tools, applying the latest techniques in test automation; e.g., data- driven te...
testautomationtools webpages testcases testsuites webstandards dataintegrity versioncontrol testautomation automationtools testenvironments applicationsecurity softwarerequirements onfigurationmanagDesign and executive test plans and test cases on computer applications. Select and develop appropriate test automation tools, applying the latest techniques in test automation; e.g., data- driven te...
regressiontesting java functionaltesting sql testcases testautomationtools webpages testsuites webstandards dataintegrity versioncontrol testautomation automationtools testenvironments pplicationsThe Software Performance Specialist Will Work With The Global Performance Testing Team To Design And Develop Load Tests For Business Requirements That Are Scalable, Repeatable, And Measurable. This I...
salescustomerservicequalityantivirusbankingtestdataloadrunnerloadtestingtestscenarioscomputerscienceagilemethodologytestenvironmentstatementsofwksowperfmancetestingdocumentationtoolBe responsible for end- to- end Business Testing and Regression Test Strategies for regular maintenance; Lead discussions with customers and mentor/ guide team in all of the above skills. Requirem...
automationseleniumjavatestngapitestingwebservicesautomationtoolsbusinesstestingmissioncriticaloperatingsystemsleadershipskillsknowledgesharingtestenvironmentsramewkingexperienceretirQubole, the leading cloud-agnostic, big data-as-a-service provider, is passionate about making data-driven insights easily accessible to anyone. Qubole delivers the industry s first autonomous data pl...
javalinuxciscoenvironmentwinningothersoverstrongcommunicationskillsbigdatatestcasestestcoveragedataprocessingproblemsolvingdefecttrackingautomationtoolstestenvironmentsommunicationskiAbout Accenture: Accenture Technology powers our clients businesses with innovative technologies established and emerging changing the way their people and customers experience work, life and e...
sqlserverproblemsolvingcomplexsystemsbusinessprocesscapacityplanninghighavailabilitytestenvironmentscommunicationskillscledatabaseExperience in Oracle Cloud Fusion Accounting hub(Release 13) and other Oracle Cloud ERP offerings. Ability to analyse source system transactions and translate them to event models in FAH. Should have ...
testdatatestscriptsgeneralledgertechnofunctionaluserrequirementsfinancialjustificationgaapcloudtechnoledgerscriptsreconciliationTestEnvironmentscletransfmationKey Responsibilities Company currently runs a series of primary care clinics throughout South & Central Mumbai and is in the process of expanding this to cover the entire Mumbai region. An initial ro...
htmljavascriptmysqlcssapirimarycarehomecarehealthcareservicessoftwaredevelopmentmedicaldevicesverbalcommunicationcommunicationskillstestenvironmentsproofofconceptspectrummanagement
Lead - Quality Assurance & Testing>> Develops testing plan scenarios for moderately complex unit , process , function , integration and acceptance testing. Assists in establishing goals for appropriat...
testcasestestingtoolscomplexsystemscomputersciencequalityassuranceusabilitytestingtestenvironmentsfinancialservicestestingsciencescriptssoftwareusabilityassurancequalemploymentopptunitysecuA Testing Engineer is required to fully test the product or system to ensure it functions properly and meets the business needs 2. Testing all aspects of the product/ system like function/ component,...
testcasesregressiontestingfunctionalcustomerrelationstechnicaldesignqualityassurancetestenvironmentsprojectadministrationhisdesigntestingmetricssoftwarebusinessusabilityassurancetingregrDaily tasks :
About Accenture: Accenture Technology powers our clients businesses with innovative technologies established and emerging changing the way their people and customers experience work, life and e...
datafeedsdataqualitymusicmakingserviceleveldataexchangebusinessrulesdataprofilingcomplexsystemsbusinessprocesstestenvironmentsmaticapowercenterThe senior automated test facilitator will work across several application team(s) to coach team members, embed processes and facilitate change. They will ensure that teams can validate the quality of...
softwarequalitymanagementtestdatatestplanningmanualtestingtestexecutiontestprocessestestmanagementtestautomationsoftwarequalitytestenvironmentsqualitymanagementtatementsofwksowJob Summary Creation and execution of Test data and Test scenarios Experience in Automation Testing with Pythonpreferred Having good Automation testing knowledge. Manage logging of test results Good ...
commandautomationmanagementpythonloggingengineeringcommunicationtestingpresentationommanagementwrittencommunicationconfigurationmanagementchangemanagementprojectmanagementtestdataautomationtestingtestenvironmentsJob Summary Creation and execution of Test data and Test scenarios Experience in Automation Testing with Pythonpreferred Having good Automation testing knowledge. Manage logging of test results Good ...
commandautomationmanagementpythonloggingengineeringcommunicationtestingpresentationommanagementwrittencommunicationconfigurationmanagementchangemanagementprojectmanagementtestdataautomationtestingtestenvironmentsShort Description Performance Test Analyst 4 to 6 Years Pune Qualifications Job Responsibilities Performance testing experience with Loadrunner and/or Performance Center Knowledge of HTTP/HTML, Web ...
loadrunnerenvironmenttestscriptshttpwebservicestestanalysisproblemsolvingdevelopertoolsbusinessprocessmonittestenvironmentscommunicationskillstestserfmancetestingingtoolsPerformance Test Engineer 4 to 6 yrs Chennai Qualifications Job Responsibilities Performance testing experience with Loadrunner and/or Performance Center Knowledge of HTTP/HTML, Web Services and Ora...
loadrunnerhttphtmlscriptingwebservicesproblemsolvingdevelopertoolsbusinessprocessmonittestenvironmentscommunicationskillsteststestingerfmancetestingingtoolsHiring for QA Automation Engineer.
About Accenture: Accenture Technology powers our clients businesses with innovative technologies established and emerging changing the way their people and customers experience work, life and e...
sqlserverproblemsolvingcomplexsystemsbusinessprocesscapacityplanninghighavailabilitytestenvironmentscommunicationskillscledatabaseShort Description Performance Test Lead 6 to 9 Bangalore Qualifications Job Responsibilities Performance testing experience with Loadrunner and/or Performance Center Knowledge of HTTP/HTML, Web Serv...
loadrunnerhtmlhttploadrunnerwebservicesproblemsolvingdevelopertoolsbusinessprocessmonittestenvironmentscommunicationskillsvugentestssizingtestingscriptserfmancetestingingtoolsacle© 2019 Hireejobs All Rights Reserved