writing technical documentation jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

writing technical documentation Job Openings

Showing 14151 - 14200 of 59410 Jobs

Sales Executive- Computer Showroom

Tanisha E- World Fresher Bhubaneswar 24 Sep, 2025

Sales

Computer Hardware

Customer Service

Relationship Building

Peripherals

Customer Consultation

Data Entry Operator, Work From Home Part Time Work

Ruppan India Nidhi Limited Fresher Bhubaneswar, JaipurJaipur, Indore, Navi Mumbai, Thane, Chandigarh, Surat, Coimbatore, Guwahati, Ahme 24 Sep, 2025

Location:

Job Type:

offline typingdata entry typingdata entry work from homedata entry operationdata entryonline typingonline data entrypart time content writing

presales consultant

BSH TECHNOLOGIES PRIVATE LIMITED Fresher Bhubaneswar 24 Sep, 2025

Work closely with the Business Development & Sales teams to support lead qualification and opportunity conversion.
Conduct r...
crmpresentationsclientsmbsoftwaresalestoolsexcelpowerpointdemosmarketproposalsstrongmandatory.knowledgesystems.serviceslikeestimationsusing

Administrative Executive

SHRI BALAJI ENTERPRISES Fresher Bhubaneswar, BaddiBaddi, Indore, Kolkata, Jamshedpur, Pune, Mumbai City, Vadodara, Ahmedabad, Guwaha 24 Sep, 2025

About the Role The Administrative Executive supports day-to-day office operations, facilitating efficient coordination among multiple departments. This role requires excellent organisational ...
communicationofficemanagementadaptabilitysupporttimeorganisationalskill

Workfront Specialist Opportunity at Capgemini - PAN India location

CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Bhubaneswar, BangaloreBangalore, Noida, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, De 24 Sep, 2025

fusion

development

Area Sales Manager (ASM)

ANYTHING SKOOL LIMITED Fresher Ranchi, Jharkhand 24 Sep, 2025

Urgent Hiring Civil Site Engineer Fresher

Classic Enterprises Fresher Ranchi, GayaGaya, Hyderabad, Lucknow, Gurugram, Kolkata, Pune, Surat, Guwahati, Ahmedabad 24 Sep, 2025

compliance monitoring

civil construction

Hiring For Clinical Research Associates

DEVIKA STAFFING SOLUTION Fresher Raipur, SurgujaSurguja, Surat, Vadodara, Oman, Qatar, Saudi Arabia, Ahmedabad, Kuwait, Gujarat, Raja 24 Sep, 2025

Hiring For Chemical Engineer

DEVIKA STAFFING SOLUTION Fresher Raipur, BhopalBhopal, Dehradun, Indore, Navi Mumbai, Pimpri Chinchwad, Thane, Pune, Haridwar, Guwaha 24 Sep, 2025

Product Manager for Dust Collection System

Spark & Ray Technocrats Private Limited Fresher Raipur 24 Sep, 2025

Mechanical Engineering

Instrumentation Engineering

Product Management

Dust Collection Systems

Sales Engineer

MAS INDUSTRIES PVT LTD Fresher Raipur 24 Sep, 2025

Identify and generate leads through market visits, networking, and referrals.
Understand customer needs and ...
sales executive activitiesfield engineeringtechnical sales

Hiring For Business Analyst

DEVIKA STAFFING SOLUTION Fresher Patna, RanchiRanchi, Darbhanga, Oman, Qatar, Bhubaneswar, Kuwait, Cuttack, United Arab Emirates, Rai 24 Sep, 2025

Store Manager Dabur India Limited

sk online services Fresher Patna, BiharBihar, JammuKashmir, Gujarat, Madhya Pradesh, Ahmednagar, Jharkhand, Karnataka, Himachal 24 Sep, 2025

Job Title: Store Manager Company: Dabur India Limited leadershipmanagementcommunication skillsmaterial receiptstore managementdispatchwarehouse operationsstock control

Assistant Sales Manager
Talent Leads HR Solutions Pvt Ltd Fresher Patna, RanchiRanchi, Bhubaneswar, Lucknow, Chandigarh, Bhopal 24 Sep, 2025

Job Description Description: Asst. Sales Manager Corporate and Private Sales Department: Sales && Business Development Experience Required: 5-6 years (Relevant Ex...
b2b saleschannel sales

Dot Net Developer
RAJKAMAL BARSCAN SYSTEMS PVT LTD Fresher Patna, KolkataKolkata, Bangalore, Chennai, Noida, Hyderabad, Gurugram, Pune, Mumbai City, Delhi 24 Sep, 2025

Software Developer (.NET|.NET Core) Experience: 2 Years Location: Andheri East, Mumbai and Remote ________________________________________ Key Skills

Technologies:...
mvc frameworkdesignproceduresdatabaseweb applications.net coremssqlstoredentity framework / ef corewindows applicationscustomer support / technical issue resolution.net developer

Dot Net Developer
Ariel Software Solutions Fresher Punjab 24 Sep, 2025

You have an exciting opportunity to join our team as a Software Developer in Mohali, Punjab. With 1 to 4 years of experience, you will be responsible for creating top-quality applications and mana...
NETHTMLCSSJavaScriptAJAXjQueryBootstrapAngularJSSQL ServerMYSQLMongoDBPostgreSQLAutofacUnityNinjectNUnitXUnitMSTestNET languages CNET framework MVCNETWeb APIReactJSNET 45Net CoreEntity Framework 6EF CoreNHibernateADONETDepende

Data Science Trainee / Junior Data Scientist
Bloom Infotech Fresher Punjab 24 Sep, 2025

As a Data Science fresher, you will be part of our team where you will have the opportunity to apply your analytical and problem-solving skills on real-world datasets. You will collaborate closely...
PythonNumPySQLData VisualizationStatisticsProbabilityPandasScikitlearn

Magento 2 Developer
Sookshum Labs Technologies Private Limited Fresher Punjab 24 Sep, 2025

As a Magento Developer at Sookshum Labs, your primary responsibility will be to develop, customize, and maintain Magento 2-based websites. You will collaborate closely with a team of developers to...
HTMLCSSJavaScriptAPIsjQueryPHPRESTSOAPUI DesignAWSGCPCommunication SkillsMagento Best PracticesRelational Database SystemsObjectOriented ProgrammingProblemSolvingOrganizational SkillsGIT Version Control

Anaesthesia Technician
ALTSEO PRIVATE LIMITED Fresher Mysore, BhubaneswarBhubaneswar, Ernakulam, Tiruchengode, Rudrapur, Navi Mumbai, Fatehgarh Sahib, Kat 24 Sep, 2025

An anesthesia technician assists anesthesiologists and other medical staff in preparing, maintaining, and monitoring equipment and supplies for anesthesia procedures. They play a crucial role in ...
medical terminologycardiopulmonary resuscitationpatient monitoringmedication administrationtechnical proficiencyemergency procedurespost-operative caresterilization techniquessterilization expertise

Purchase & Store Executive
SEQRONICS (INDIA) PRIVATE LIMITED Fresher Mysore 24 Sep, 2025

Position:Purchase Executive / Procurement Officer Experience:Minimum1 years Education:Diploma/BE in Electricals & Electronics...
dispatch planningpurchase management

Medical scribe
ALTSEO PRIVATE LIMITED Fresher Mysore, BhubaneswarBhubaneswar, Ernakulam, Vishakhapatnam, Amritsar, Dhubri, Kohima, Patna, Sagar, C 24 Sep, 2025

Medical Scribe Job Responsibilities: Prepares and assembles medical record documentation/charts for physician(s). Enters the patient room with the physician during patient visit to capture an...
medical recordshealth information managementmedical servicesrecord keepingconfidentialityanalytical skillspatient care coordinationelectronic health recordsclinical knowledge

Virtual Data Entry Clerk Office Operations
Divine HR Services Fresher Mysore, ChennaiChennai, Bangalore, Howrah, Tamil Nadu, Indore, Gangtok, Mumbai City, Port Blair, Coi 24 Sep, 2025

Dear Candidate, Well provide you Typing, SMS Sending, Ads Posting etc. online works which you can do by mobile orPosition Available: Fresher / Back Office / Computer Operator / Data Entry Opera...
data entryback officepart timeback office operationsenglish writingcomputer operating

Online Work From Home, Part Time Data Entry Typing , Computer Operator Typist
Ruppan India Nidhi Limited Fresher Mysore, NashikNashik, Dehradun, Mohali, Bathinda, Anand, Amritsar, Udaipur, Vadodara, Panchkula 24 Sep, 2025

We offer a Data Entry Job that allows you to work from home. This is a part-time position that includes online data entry tasks, online computer work, part time jobs, work from home, back office ...
typingdata entrypart timecontent writingenglish typingback officehome based onlinework from homecomputer operating

Siddha and Homeopathy
CORE 2 CODE Hiring For C2C Healthcare Fresher Madurai, TiruchirappalliTiruchirappalli, Coimbatore, Chennai, Salem, Cuddalore 24 Sep, 2025

Dear candidate I am Lavanya HR at C2C Healthcare We are hiring 50 -100 Siddha and Homeopathy candidate for the position of Junior Medical Coders Eligibility Siddha and Homeopathy 2019 - 2025...
anatomycommunication skillsenglishinterpersonal skills

Solar PV Installation & Maintenance Trainer
DIDYU TECHNOLOGIES PRIVATE LIMITED Fresher Madurai, TiruchirappalliTiruchirappalli, Thanjavur, Erode, Coimbatore, Chennai, Salem, Sivakasi, Kri 24 Sep, 2025

Job Title: Solar PV Installation & Maintenance Trainer Location: Chennai solar pvstandardsmaintenanceinstallationprotocolssafetysolarsolar project field experience

HR Operational & Engagement Executive
Techmango Technology Services Fresher Madurai, Tamil Nadu 24 Sep, 2025

The HR Operations & Engagement Executive role at our IT service company in Madurai requires a candidate with a minimum of 2 years of experience. As an HR Operations & Engagement Executive, you wil...
HR OperationsEmployee EngagementHR CompliancePerformance ManagementInternal CommunicationAppraisal ProcessesEmployee Lifecycle ManagementEmployee Databases

Data Entry Operator, Work From Home Part Time Work
Ruppan India Nidhi Limited Fresher Madurai, ErodeErode, Kochi, Raipur, Rajkot, Faridabad, Jalandhar, Ludhiana, Nagpur, Bhopal 24 Sep, 2025

We are offering a Job. Data Entry Operator, Computer Operator, Back Office Executive, Typist Enter and update data into various systems and databases. Verify accuracy of data before entering it...
offline typingdata entrydata entry work from homeonline typingonline data entrydata entry operationoffline data entrypart time content writing

Hiring For Quality Engineer
DEVIKA STAFFING SOLUTION Fresher Ludhiana, ChandigarhChandigarh, Sikar, Nagaur, Navi Mumbai, Thane, Kharagpur, Pune, Mumbai City, Bhi 24 Sep, 2025

were seeking an experienced quality engineer to build upon this reputation with an unwavering commitment to meticulous production. The ideal candidate is an exceptionally organized, methodical pr...
maintenancesupervisionquality

Content Marketing Executive
FlyMedia Technology -IT Company Fresher Ludhiana, Punjab 24 Sep, 2025

As a Content Strategist, you will play a crucial role in leading content planning and execution across various platforms. Your primary responsibility will be to develop engaging content strategies...
Campaign ConceptsAnalyticsContent StrategistContent PlanningContent ExecutionCrafting Engaging Content StrategiesWriting Core MessagingCollaboration with Creative TeamsContent CalendarsStorytelling FrameworksCompelling CopywritingBriefScript Pr

Business Development Manager
Niyukti Management Consultants Hiring For Niyukti Fresher Ludhiana, Chandigarh 24 Sep, 2025

Job Summary:
We are looking for a results-driven and motivated Business...
insurancearea salesagency salesbusiness developmentlife insurance

Position Project Manager {Project Planning & Co-ordination (For TFL & NRL)
HR JOBS CONSULTANCY Fresher Lucknow, NoidaNoida, Ghaziabad, Bangalore, Indore, Chattisgarh, Hyderabad, Kolkata, Gurugram, Chandi 24 Sep, 2025

Position: ProjectManager {Project Planning & Co-ordination (For TFL & NRL) Qualification: B.E, Mechanical Experience: 15-25 Years of relevant experience. Experience in Project Planning, Schedu...
project managementproject coordination

Computer Operator / Data Entry Clerk
Divine HR Services Fresher Kollam, BangaloreBangalore, Howrah, Chennai, Hyderabad, Tiruchirappalli, Pondicherry, Thane, Pune, T 24 Sep, 2025

Position:Entry-Level / Back Office Assistant / Computer Operator / Data Entry Clerk. Job Type: Part-time / Home-Based / Flexible Experience: 0-1 Year Salary Range: 3.0 - 7 LPA Work Location: ...
typingback office operationsback officepart timedata entryenglish writing

Part Time Teacher (Urgent Hiring)
Planet Spark Fresher Thiruvanananthapuram, CoimbatoreCoimbatore, Haryana, Maharashtra, Rajasthan, Uttar Pradesh, Gwalior, 24 Sep, 2025

Key Responsibilities (What You will Do):

Take fun one-on-one demo classes using ...
online tuitiontesolteachingieltslanguage teachingenglish language learningtutoringonline teaching

Workforce Services Senior Analyst (Capacity Planning)
Albireo Recruiters Hiring For Accenture Fresher Kakinada, GunturGuntur, Hyderabad, Kurnool, Nellore, Chittoor, Guntakal, Anantpur, Bangalore, Chenna 24 Sep, 2025

Role Workforce Services Senior Analyst (Capacity Planning) Responsible for developing and managing accurate mid to short-term Capacity planning models. These forecasts inform staffing, budgeting...
cross functional coordinationcapacity managementms excelshrinkage controlworkforce managementcontact centeroccupancy planningsla managementaht

Hiring For Mining Engineer
DEVIKA STAFFING SOLUTION Fresher Kochi, KeralaKerala, Assam, Tamil Nadu, Bokaro, Dhanbad, Andhra Pradesh, Jharkhand, West Bengal, Him 24 Sep, 2025

Our company is growing rapidly and is searching for experienced candidates for the position of mining engineer. We appreciate you taking the time to review the list of qualifications and to apply...
miningmaintenancesupervisionquality

Workforce Services Senior Analyst (Capacity Planning)
Albireo Recruiters Hiring For Accenture Fresher Kakinada, GunturGuntur, Hyderabad, Kurnool, Nellore, Chittoor, Guntakal, Anantpur, Bangalore, Chenna 24 Sep, 2025

Role Workforce Services Senior Analyst (Capacity Planning) Responsible for developing and managing accurate mid to short-term Capacity planning models. These forecasts inform staffing, budgeting...
cross functional coordinationcapacity managementms excelshrinkage controlworkforce managementcontact centeroccupancy planningsla managementaht

Logistics Officer
SHARMA ENTERPRISES Fresher Kakinada, GunturGuntur, Hyderabad, Kurnool, Nellore, Guntakal, Anantpur, Dhubri, Dibrugarh, Guwahati 24 Sep, 2025

We are looking for a detail-oriented and organized Logistics Officer to join our team. The Logistics Officer will be responsible for coordinating the transportation, storage, and distribution of ...
supply chain managementcustomer serviceinventory managementproblem solvingadaptabilitylogistics managementdelivery operationsteamwork

Executive assistance
ASSETCARE SERVICES PRIVATE LIMITED Fresher Kakinada, HyderabadHyderabad, Ongole, Kadapa, Chittoor, Bangalore, Chennai, Gurugram, Kolkata, Delhi 24 Sep, 2025

An executive assistantprovides high-level administrative support to senior management by managing schedules, coordinating meetings, handling communications, preparing reports,...
communicationtechnicaldetailexperienceattentionproficiencyproblem-solvingorganizational

Opportunity International Chat Support Onsite Role in Hyderabad
ARTECH INFOSYSTEMS PRIVATE LIMITED Fresher Kakinada, HyderabadHyderabad, Kurnool, Vijayawada, Andhra Pradesh 24 Sep, 2025

I hope youre doing well! We came across your profile and were impressed by your experience in customer support. Were currently hiring for an exciting role as an International Chat Suppor...
technical supportinternational call centerinternational bpocustomer supportvoicechatesupportchat process

Content & Copywriting Intern/Trainee
Marketing as Sales support Fresher Kochi, Kerala 24 Sep, 2025

Role Overview: As a part of MaSs, a digital marketing agency based in the UK with operations in Kochi, you will be part of a team that focuses on vibe marketing - creating messages that stand out,...
CopywritingContent CreationEditingGrammarAdaptabilityFeedbackCreativityAI Tools

Software Developer (Full Stack)
EY Fresher Kochi, Kerala 24 Sep, 2025

Role Overview: At EY, youll have the opportunity to build a unique career with global scale, support, inclusive culture, and technology to help you become the best version of yourself. Your unique...
SQLMicrosoft AzureAngularETL technologyMicrosoft Azure Data ServicesAzure Data FactoryDatabricksAzure Data Lake StoreDatabase conceptsData LakeWeb APIPowerBIPowerAppsPowerAutomatePMI

Hiring For Mining Engineer
DEVIKA STAFFING SOLUTION Fresher Kochi, KeralaKerala, Assam, Tamil Nadu, Bokaro, Dhanbad, Andhra Pradesh, Jharkhand, West Bengal, Him 24 Sep, 2025

Our company is growing rapidly and is searching for experienced candidates for the position of mining engineer. We appreciate you taking the time to review the list of qualifications and to apply...
miningmaintenancesupervisionquality

Junior Angular Developer
HighQ-Labs Pvt Ltd Fresher Kochi, Kerala 24 Sep, 2025

You will be responsible for developing and maintaining code in accordance with predefined cost, company, and security standards. Your role will involve working on bug fixes, supporting the mainten...
rest apiSQLMongoDBsoftware programmingHTMLCSSAngular 2Hibernate Java

Delivery Manager
SHARMA ENTERPRISES Fresher Kochi, ThrissurThrissur, Kollam, Ernakulam, Idukki, Kozhikode, Palakkad, Thiruvanananthapuram, Wayan 24 Sep, 2025

We are looking for delivery manager oversees the planning, execution, and successful delivery of a project or product, ensuring it meets timelines, budget, and quality standards. They act as a ce...
team managementproblem solvingproject executionstakeholder managementrisk managementproject planningquality assurance

SEO Specialist
Law Prep Tutorial Fresher Jodhpur, Rajasthan 24 Sep, 2025

You should have 2 to 6 years of experience to apply for the role of SEO Specialist at Law Prep Tutorial. As an SEO Specialist, you will be responsible for leading and implementing organic growth s...
SEOAnalytical skillsEdtechContentled SEOTechnical SEOOnpage implementationSearch intentContent hierarchySEO content frameworksSEO tools

Application Sales Jodhpur (IVD)
ACCUREX BIOMEDICAL PRIVATE LIMITED Fresher Jodhpur, Rajasthan 24 Sep, 2025

As an Application Sales Specialist at Accurex Biomedical in Jodhpur, you will be responsible for providing clinical application support and driving sales in the IVD domain. Your role will involve...
Application SupportSalesMarket IntelligenceDiagnostic InstrumentsCustomer Queries

Export Sales Manager - Commodity
The Talent Quest Fresher Jodhpur, Rajasthan 24 Sep, 2025

As an Assistant Manager - Sales at our company, you will be responsible for managing client interactions, increasing sales, and ensuring smooth export procedures. Your primary duties will include ...
SalesMarket ResearchRelationship ManagementExport KnowledgeCommodities Trading

Production Manager
YOUTAG INFOTECH PRIVATE LIMITED Fresher Jodhpur, JaisalmerJaisalmer, Bhiwadi, Navi Mumbai, Bankura, Uttar Dinajpur, Thane, Mumbai City, Daks 24 Sep, 2025

We are looking for an experienced Production Manager to organize and oversee the manufacturing of goods. You will be ultimately responsible for the smooth running of all production lines and the ...
prosperitypressure transient analysismbalproduction managementproduction engineeringtechnical productionnodal analysis

General Practitioner
ALTSEO PRIVATE LIMITED Fresher Jodhpur, ThanjavurThanjavur, Kottayam, Imphal, Dhanbad, Pondicherry, Kolkata, Bhillai, Coimbatore, S 24 Sep, 2025

General Practitioner (GP) job description outlines the responsibilities and requirements for a physician who provides primary care, managing the health and well-being of patients across a wide ra...
medical proceduresmedical terminologyclinical pathologyemergency responsemedical practice operationsmedical transcriptionpatient careanatomy physiologyphysical examinations

Part Time , Data Entry , Online Typing , Home Based , Work From Home
Ruppan India Nidhi Limited Fresher Jodhpur, KotaKota, Gwalior, Kurnool, Jabalpur, Vapi, Vijayawada, Thrissur, Ambala, Cuddalore 24 Sep, 2025

We are offering a Job. Part Time Jobs, Data Entry Work, Online Computer Work, Work From Home, Back Office Executive, Typist, Online Typing Jobs Freshers and Experienced both can apply for this j...
data entrycomputer operatingcontent writingback officeonline work from homedata entry typing

PREV
NEXT

writing technical documentation Job Openings

About the Role The Administrative Executive supports day-to-day office operations, facilitating efficient coordination among multiple departments. This role requires excellent organisational ... communicationofficemanagementadaptabilitysupporttimeorganisationalskill

Job Title: Store Manager Company: Dabur India Limited leadershipmanagementcommunication skillsmaterial receiptstore managementdispatchwarehouse operationsstock control

Job Summary:

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

About the Role The Administrative Executive supports day-to-day office operations, facilitating efficient coordination among multiple departments. This role requires excellent organisational ...
communicationofficemanagementadaptabilitysupporttimeorganisationalskill