channel strategies jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

channel strategies Job Openings

Showing 28101 - 28150 of 34737 Jobs

Assistant Manager - PL - Prospect

Bajaj Finserv 2.00 to 4.00 Years Chandigarh 01 Apr, 2024

Relationship Management

Productivity Management

Communication Skills

Motivation

Finance Penetration

Hiring For Sales Agency Development Insurance

Niyukti Management Consultants Hiring For Niyukti Management Consultants 4.00 to 9.00 Years Chandigarh 01 Apr, 2024

Required Agency Development Manager

Life Insurance Co. Ltd.

Sales Manager India

KKD Consulting Hiring For Clients 2.00 to 7.00 Years Chandigarh 01 Apr, 2024

KKD IS HIRING

Job Title: Sales Manager - Agency Channel

Company Overview:

outside sales

cold calling

Business Development Manager

KKD Consulting Hiring For Clients 2.00 to 7.00 Years Chandigarh 01 Apr, 2024

KKD IS HIRING

Job Title: Sales Manager - Agency Channel

Company Overview:

sales

outside sales

Cluster Manager Agency(Life Insurance) Haryana

Lavya Associates HR Services Hiring For Leading Life Insurance Companies 5.00 to 10.00 Years Chandigarh 01 Apr, 2024

He/She will be responsible for handling an on roll team of 8 -10 sale...
bfsiagencysaleslife insuranceinsuranceagency salesteam handlingagency channel

Cost Accountant

Innova Captab Ltd 4.00 to 5.00 Years Panchkula 01 Apr, 2024

SAP FICO

Customer Care Representative

BHARTI HR CLEANER WALA ZEEVIKA JOBS Hiring For Optistaff Solution Private Limited 0.00 to 4.00 Years Panchkula 01 Apr, 2024

customer relationship

customer care

customer service management

customer support

customer service delivery

Sales opening in Aditya Birla Sun Life Agency Channel (Field Sales)

ADITYA BIRLA SUN LIFE INSURANCE COMPANY LIMITED 1.00 to 6.00 Years Chandigarh 01 Apr, 2024

Agency channel--Field Sales

Aditya Birla Sun Life Insurance

Medical Representative (Pharma)

Himscout Recruiters 1.00 to 6.00 Years Mohali 01 Apr, 2024

Responsible forSales Of Branded Generic Healthcare Formulation at the Stockist, wholesaler, and Retail Levels.
The candidate will be responsible for making sales and maintainin...
b2b salespharma salespharma marketingbusiness developmentsalesmedical

Sales Executive

Himscout Recruiters 1.00 to 6.00 Years Chandigarh 01 Apr, 2024

Responsible forSales Of Branded Generic Healthcare Formulation at the Stockist, wholesaler, and Retail Levels.
The candidate will be responsible for making sales and maintainin...
pharma salesmedical salesdirect salespharmaceutical salessales managementgeneric drugspharma marketing

Manager, Human Resources

Teach For India 2.00 to 5.00 Years Chennai 01 Apr, 2024

Performance Management

Face to Face Fundraising Executive

ChildFund India 0.00 to 3.00 Years Chennai 01 Apr, 2024

SUMMARY

fundraising

communication skills

resource mobilization

deal closure

sales presentations

Practice Manager

MILLENNIUM BABYCARES PRIVATE LIMITED 10.00 to 20.00 Years Chennai 01 Apr, 2024

team management

front office

business process outsourcing

logistics coordination

management

supply chain operations

practice operations

property management systems

guest service management

manager

Team Lead, Technology, Project Management, Corporate Banking; Lead...

DBS Bank 8.00 to 12.00 Years Chennai 01 Apr, 2024

Site Reliability Engineering

NRI-RM & Acquisition NR-RM

Acura Solutions Hiring For Reputed Bank 3.00 to 8.00 Years Chennai 01 Apr, 2024

Job Title

Industry:

Qualifications

Functional Area:

nri services

field sales

relationship management

sales

customer acquisition

Branch Manager

BETTER HIRE 6.00 to 10.00 Years Chennai 01 Apr, 2024

We are looking for a results-driven Branch Manager to ensure that sales goals are met and office tasks are completed successfully in a timely manner. Branch Managers are also responsible ...
branch managementbranch accountingaccounts finalisationbranch operationbranch bankingbranch administration

Branch Manager
BETTER HIRE 3.00 to 6.00 Years Chennai 01 Apr, 2024

We are looking for a results-driven Branch Manager to ensure that sales goals are met and office tasks are completed successfully in a timely manner. Branch Managers are also responsible ...
branch accountingbranch bankingaccounts finalisationbranch operationsbranch handlingbranch administration

Regulatory Affairs Specialist
TECHNO ENDURA 0.00 to 2.00 Years Chennai 01 Apr, 2024

Regulatory Affairs Specialist Job Description Responsibilities:

Prepare and submit regulatory documentation for new and existing medical products,including drugs,devices,and biol...
regulatory requirementsregulatory mattersregulatory guidelinesregulatory affairs

Medical Device Regulatory Affairs
TECHNO ENDURA 0.00 to 2.00 Years Chennai 01 Apr, 2024

Medical Device Regulatory Affairs Job duties of a Regulatory Affairs Specialist include:

Developing and implementing regulatory strategies for new and existing products

Pre...
regulatory strategy developmentregulatory mattersregulatory auditregulatory guidelinesmedical devicesregulatory affairs

Vacant Sales Managers For FMCG, Pharma, OTC, Personal care
Adidev Herbals Pvt Ltd 1.00 to 6.00 Years Bangalore 01 Apr, 2024

Required Regional / Area Sales Managers / Business development manager/Sales Executives/ Beauty Parloursales executives to market Herbal, Beauty & Personal care products/Health care products, Ayu...
personal careskin carepharmaceutical salesfmcg channel salesanti-aging productscosmetics

Data Analyst (Power BI, Python, SQL)- Internal Audit domain, Bangalore
Talent Leads HR Solutions Pvt Ltd 3.00 to 8.00 Years Bangalore 01 Apr, 2024

Qualification- Mba Finance / Mca Experience 3 years Location Bangalore BO. 5.5 Days working from Office Key responsib...
sqlpowerdata analysisdatapython

Marketing Manager
MILLENNIUM BABYCARES PRIVATE LIMITED 13.00 to 23.00 Years Bangalore 01 Apr, 2024

An Email Marketing Manager utilizes email communication tools to market a company and increase brand awareness. They are experts in the usage of email communications and develop marketing strateg...
marketservicemarketinganalyticscampaignspowerpointcustomerresearchmanagementdigitalprojectntegratedstrong

Training Placement Officer
SKIPS University 5.00 to 9.00 Years Ahmedabad 01 Apr, 2024

Position Overview: As a Training and Placement Officer will play a pivotal role in connecting students with career opportunities by facilitating Students training, skill development, and eventual...
Strong communication skillsData managementStakeholder engagementDatabase managementNetworking abilitiesUnderstanding of student needsindustry requirementsCareer counselingMicrosoft Office SuiteKnowledge of industry trends

Teacher in D.A.V. School
RENOVISION TECHNOLOGY 0.00 to 1.00 Years Ahmedabad 01 Apr, 2024

Classroom teachers will be expected to:

have the content knowledge and pedagogical practice to meet the diverse needs of all students teacher trainingeducation policystudent disciplinecharter schoolsschool boards

Lead - Talent Management
Adani Group 15.00 to 19.00 Years Ahmedabad 01 Apr, 2024

Purpose of the role:- Reporting to the Group Head, Talent and Leadership Development, the Succession Planning & Assessment Leader will be responsible for developing a pipeline of ready-to-deploy,...
Succession PlanningTalent ManagementLeadership DevelopmentOrganizational PsychologyChange ManagementTalent Assessment

Business Head
Gallops group 10.00 to 14.00 Years Ahmedabad 01 Apr, 2024

Company Description We suggest you enter details here. Role Description This is a full-time on-site role located in Ahmedabad for a Business Head in Automobile Dealership. The Business Head ...
SalesMarketingFinanceInventory ManagementCustomer ServiceBusiness GrowthRelationship BuildingCustomer SatisfactionLeadershipNegotiationAutomotive Market KnowledgeFinanceBudgeting

Talent Acquisition Manager
Bethel Group 5.00 to 9.00 Years Ahmedabad 01 Apr, 2024

Bethel Group is looking to hire for a *Talent Acquisition Manager* role for one of the leading luxury automobile brand. Job Location - Ahmedabad, Gujarat Budget - Upto 11 lpa Responsibilities: ...
Talent AcquisitionRecruitmentManpower PlanningSuccession PlanningSourcingInterviewingCandidate AssessmentCommunication SkillsNegotiation SkillsInterpersonal SkillsTeam HandlingTalent Pipeline ManagementRecruitment Process ImprovementIndustry

Assistant Manager Business Development
Unison Globus 3.00 to 7.00 Years Ahmedabad 01 Apr, 2024

Company Description Unison Globus is a Florida-based company that has been catering to the needs of CPAs, EA, and Accounting professionals in North America, Australia, New Zealand, and Singapore ...
Business DevelopmentSalesClient Relationship ManagementAccount ManagementCommunicationInterpersonal SkillsAnalytical SkillsMicrosoft OfficeProblemSolving SkillsFinancial KnowledgeAccounting KnowledgeTax Preparation Services

Dy. Manager - Channel Sales
Bluecrest HR Consulting Private Limited 4.00 to 9.00 Years Vishakhapatnam 30 Mar, 2024

Post: Dy. Manager - Channel Sales Reports to : Regional Sales Head Channel Management Education : Diploma / Bachelor of Engineering / Tech (Chemicals/M...
chemical salesequipment salescustomer relationshipindustrial saleschannel salessales process

Bancassurance Channel ( CTC up to 5 LPA)
Trenz Management Services 1.00 to 6.00 Years Vishakhapatnam 30 Mar, 2024

We are hiring a leading life insurance company to join our team. Be a part of our life insurance sales team and join us in our mission of protecting India with pride! insurancesales

Business Head , AP & Telangana
Talent Leads HR Solutions Pvt Ltd 12.00 to 17.00 Years Vijayawada 30 Mar, 2024

Description: 1. To direct Sales & Business Development Team and establish coverage, Distribution and Display objectives in line with Business Plan. 2. Direct the Sales and Busines...
general tradesales

International Product Head
MNR Solutions Pvt Ltd 5.00 to 10.00 Years Vijayawada 30 Mar, 2024

Hi Greeting from MNR Solutions Hiring for International Product Head for Logistice Industry JOB SUMMARY The role is responsible for achieving budgeted International sales t...
b2b salesinternational saleskey account mangement

Business Analyst Urgent Vacancy
RENUKA INTERPRISES 0.00 to 4.00 Years Vellore 30 Mar, 2024

We are hiring a business analyst to join our project team. You will work alongside other business analysts and report directly to the project manager. Your main tasks will include performing deta...
analysisdata analysissqlbusiness analysis

Hiring For Business Analyst
Divya Staffing Solution 0.00 to 4.00 Years Vellore 30 Mar, 2024

We are hiring a business analyst to join our project team. You will work alongside other business analysts and report directly to the project manager. Your main tasks will include performing deta...
project managementbusiness processsoftware testingdata analytics

Business Analyst Opening
Divya Staffing Solution 0.00 to 4.00 Years Vellore 30 Mar, 2024

We are hiring a business analyst to join our project team. You will work alongside other business analysts and report directly to the project manager. Your main tasks will include performing deta...
business processdata analyticssoftware testingproject management

Key Account Manager, Federal Bank
Tata AIA Life Insurance Company Limited 1.00 to 5.00 Years Vellore 30 Mar, 2024

Greeting from Tata AIA Life Insurance. We have opening forFederal Bank channel. Designation:Key Account Manager Role Summary: Provide support in Sale...
banca salesbancassurancelife insurance

Area Sales Manager(ASM) for Banca Channel -Health Insurance
Career Shaper Hiring For Hiring for Leading Health Insurance Company 4.00 to 9.00 Years Varanasi 30 Mar, 2024

Minimum 4 years Banca sales team handling experience required

Health Insurance candidates are first preference

Minimum 5 years HILI Banca Sales experience required insurancebancasurancebancassurance salesalternate channelbanca salesbancassurancebanca

Assistant Manager
Contrywide 3.00 to 5.00 Years Varanasi 30 Mar, 2024

Company Description We suggest you enter details here. Role Description This is a full-time on-site role for an Assistant Manager located in Varanasi. The Assistant Manager will be responsible ...
CommunicationInterpersonal skillsCritical thinkingMicrosoft OfficeProject managementTeam managementCollaborationStrong leadershipProblemsolvingDecisionmakingOrganizational skills

Territory Growth Manager
Ashirvad Pipes 3.00 to 7.00 Years Varanasi 30 Mar, 2024

Role Purpose: Responsible for managing sales of Ashirvads products in the defined geographic area and ensure consistent, profitable growth in sales revenues. Identify objectives, strategies and a...
Sales PlanningSales ExecutionSales StrategiesMarket AnalysisNegotiationChannel DevelopmentMarketing InitiativesTrade Promotion

Marketing Manager
IMS Learning Resources Pvt Ltd 3.00 to 7.00 Years Varanasi 30 Mar, 2024

Company Description IMS Learning Resources Pvt. Ltd. is a pioneering institution in management education training in India. Established in 1977, IMS has expanded into various sectors, providing t...
Market researchAnalytical skillsCommunication skillsProject managementDigital marketingMarketing strategiesProblemsolving skills

Branch Manager ( Agency Manager )
Sunrise Management and Services Hiring For Shri Ram Life Insurance 3.00 to 8.00 Years Varanasi 30 Mar, 2024

Agency Channel - Branch Manager

Number of Customer meeting per day

To achieve BDO wise targets.(New & Customer Retention) insurance salesagent recruitmentagency salessales

FOR Agency Development Manager ( Life Insurance )
Niyukti Management Consultants Hiring For Niyukti Management Consultants 5.00 to 10.00 Years Varanasi 30 Mar, 2024

Required Agency Development Manager Life Insurance Co. Ltd. Salary-2-4Lac Exp -3-12 Year In sales Location Delhi/Ncr, Noida, Gorgaon ,Lucknow, Kanpur, Varanasi,Jaipur, Chandigarh, Faridabad,K...
direct salesinsurancechannel saleslife insurancesalesdevelopmentbusinessinsurance salestelecom salesterritory sales managerunit manageragency development managersr.sales managerdevelopment managerbusiness development managerrelationship man

Hiring For Sales Manager( Home Loans )
HIRING PLUS HR SOLUTION PRIVATE LIMITED 1.00 to 5.00 Years Varanasi 30 Mar, 2024

Will be responsible to manage sales of Home Loans in given region. Sourcing of New Business from Walk-in Customer and through Empaneling DSAs & Connectors, Cold calling, open Market & Cross Sel...
banking saleshome loansmortgage loansbusiness loancasa salescross salesloan agreementbfsi saleslap

Branch Manager
DREAMS SOLUTIONS 5.00 to 10.00 Years Varanasi 30 Mar, 2024

Role/ Job Title: Branch Manager-Micro Business Loan Function/ Department: Micro Business Loans Job Purpose: The role entails scaling up the business for the M...
lapteam managementbusiness loanbranch managementunsecured loanspersonal loans

Data Analyst
CIEL HR 0.00 to 1.00 Years Vadodara 30 Mar, 2024

Job Title - Data Analyst Job Location - Vadodara, Gujarat CTC - Best in Industry Experience - 0-1 years (Freshers can apply) Job Role & Responsibility - Develop AI / ML solutions using data s...
data scienceadvanced analyticsdata miningSQLAWSPythonJava

International Chemical Sales Representative
Synergy Resource Solutions 4.00 to 7.00 Years Vadodara 30 Mar, 2024

Greetings from Synergy Resource Solutions, a leading HR Management Consultancy Firm. Our Client is an international food, fiberglass & chemical products Company Successfully Providing Distributi...
MarketingInternational SalesBusiness Development

Key Account Manager-IDFC First
Tata AIA Life Insurance Company Limited 1.00 to 4.00 Years Vadodara 30 Mar, 2024

Position Overview

Position Title Key Account Manager.

Department IDFC Firs...
bancassurance saleslife insurancebfsi salesdirect sales

Store Manager
Mohinder Singh Hiring For Farm 1.00 to 6.00 Years Udaipur 30 Mar, 2024

Responsibilities

Develop business strategies to raise our customers pool, expand store traffic and optimize profitability

Meet sales goals by training, motivating, mentori...
store managementstore operationsstores maintenanceassociate developmentstore keepingstore merchandising

Agent Sales Manager
TEKPILLAR 2.00 to 5.00 Years Udaipur 30 Mar, 2024

HIRING HIRING HIRING HIRING HIRING Job description Urgent opening for a Sales Manager Recruiting advisors, handling the team & generating business from them Mot...
salesbankinginsurancemarketingcasafmcg salespharmaconsumer durableschannel

Logistics Controller
Prime Placement Vision Pvt Ltd 0.00 to 4.00 Years Udaipur 30 Mar, 2024

A Logistics Controller, sometimes referred to as a Logistics Manager or Supply Chain Controller, is responsible for overseeing and managing all aspects of logistics and supply chain operations wi...
reverse logisticsthird-party logisticslogistics coordinationlogistics operationslogistics

PREV
NEXT

channel strategies Job Openings

Regulatory Affairs Specialist Job Description Responsibilities: Prepare and submit regulatory documentation for new and existing medical products,including drugs,devices,and biol... regulatory requirementsregulatory mattersregulatory guidelinesregulatory affairs

Responsibilities Develop business strategies to raise our customers pool, expand store traffic and optimize profitability Meet sales goals by training, motivating, mentori... store managementstore operationsstores maintenanceassociate developmentstore keepingstore merchandising

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Regulatory Affairs Specialist Job Description Responsibilities:

Prepare and submit regulatory documentation for new and existing medical products,including drugs,devices,and biol...
regulatory requirementsregulatory mattersregulatory guidelinesregulatory affairs

Responsibilities

Develop business strategies to raise our customers pool, expand store traffic and optimize profitability

Meet sales goals by training, motivating, mentori...
store managementstore operationsstores maintenanceassociate developmentstore keepingstore merchandising