consumer electronics jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

consumer electronics Job Openings

Showing 2201 - 2250 of 5696 Jobs

Marketing Executive

RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Bangalore,Chennai, Bhagalpur, Noida, Hyderabad, Gurugram, Pune, Delhi, Patna, Guwahati 03 Apr, 2025

marketing research

marketing communication

marketing management

brand management

marketing

Embedded Systems Engineer Smart TV, App & IoT Integration Part-time/Full-time

Forofuse Labs 2.00 to 6.00 Years Vadodara,Other Gujarat 01 Apr, 2025

Mobile App Integration

Smart Lighting

API Integration

Support Engineer - Product Support

Hex Wireless 0.00 to 4.00 Years Vadodara,Other Gujarat 01 Apr, 2025

Technical Documentation

Customer Satisfaction

Content Creation

ProblemSolving

Product Software Support

Client Software Versions

Integration

Deployment

Junior Full Stack Developer

Ooze IT Solutions 1.00 to 5.00 Years Udaipur,Other Rajasthan 01 Apr, 2025

Deputy Manager - Business Development

Saurashtra Enviro Projects Private Limited 5.00 to 9.00 Years Surat,Other Gujarat 01 Apr, 2025

Consumer behavior analysis

Assistant Manager Costumer Marketing

Diageo 2.00 to 6.00 Years Ranchi,Other Jharkhand 01 Apr, 2025

Analyticalreasoning skills

Communicationnegotiation skills

Collaboration skills

ROI Orientation

Manager - Electronic R & D

MACPOWER CNC MACHINES 7.00 to 11.00 Years Rajkot,Other Gujarat 01 Apr, 2025

CNC

PLC

Robotic Automation

Selection of ControlAutomation Components

Building Control architecture using Electrical Design Tool

Machine Interface programming

Senior Market Research Analyst

ENLIVEN DIGITAL CONTENT 3.00 to 7.00 Years Rajkot,Other Gujarat 01 Apr, 2025

Written Communication

Verbal Communication

Market Trends Analysis

Consumer Behavior Analysis

Competitive Landscapes Analysis

Quantitative Research Methodologies

Qualitative Resear

Android / Flutter Developer

Arity infoway 2.00 to 6.00 Years Rajkot,Other Gujarat 01 Apr, 2025

Android SDK

JAVA

Object Oriented Programming

RESTful Web Service Integration

Google Play Store

Design & Estimation Engineer

:One Plus Consultant 2.00 to 6.00 Years Rajkot,Other Gujarat 01 Apr, 2025

Autocade

Area Sales Manager - Cross Sell

Champion Agro 3.00 to 7.00 Years Rajkot,Other Gujarat 01 Apr, 2025

Sr. Visual Merchandiser

Urbolife Exclusive 2.00 to 6.00 Years Raipur 01 Apr, 2025

Organizational Skills

ProblemSolving

Recovery Manager

KHTE Pvt Ltd Recovery Solutions 1.00 to 5.00 Years Patna,Other Bihar 01 Apr, 2025

Financial Data Analysis

Loan Management Software

Electronics Engineer

Divya Staffing Solution 0.00 to 4.00 Years Patna,Purnia, Guntur, Kurnool, Chandigarh, Bhavnagar, Bhillai, Vasco Da Gama, Korba, Bastar 01 Apr, 2025

Marketing Executive

RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Patna,Bhagalpur, Bangalore, Chennai, Noida, Hyderabad, Gurugram, Pune, Delhi, Guwahati 01 Apr, 2025

marketing research

marketing communication

marketing management

brand management

marketing

Process Analyst

Provana India Private Limited 0.00 to 1.00 Years Noida 01 Apr, 2025

Role:

Hardware Manager

Sai Computers Limited 5.00 to 9.00 Years Meerut,Other Uttar Pradesh 01 Apr, 2025

Hardware Asset Management

Inventory Tracking

IT Hardware Maintenance

MRI Devices

Handheld Billing Machines

Networking Peripherals

AMC Management

ProblemSolving Skills

Field Sales Officer - Plastic Industry

O3Hire Hiring For O3hire 0.00 to 4.00 Years Lucknow,Kanpur, Varanasi 01 Apr, 2025

Itactively selling plastic products manufactured by a company to various industries, requiring a strong understanding of plastic materials, applications, and market trends, w...

outside salesplasticfurniture salesfield worksalesb2cb2b sales

Apply Business Development Manager Insurance Salary upto-4Lac

Niyukti Management Consultants 4.00 to 9.00 Years Ludhiana,Chandigarh, Jalandhar, Amritsar, Patiala, Jaipur, Karnal, Jodhpur, Kurukshetra, Yamunanagar 01 Apr, 2025

Opening in Agency And Direct Channel Jalandhar & ludhiana location.

ATS Infovision 2.00 to 6.00 Years Ludhiana,Chandigarh, Jalandhar, Amritsar, Una, Dharamshala, Solan, Shimla 01 Apr, 2025

Dear Candidates, Greetings of the day! You can contact us on Mobile No. :hidden_mobile or just a message on whatsapp with Yes to get a call back agency channelagency developmentbusiness developmentagencyassociate developmentlife insurance

MNC Apprenticeship Trainee Program_ Freshers
RECRUDO LABS LLP 0.00 to 1.00 Years Kochi,Bangalore, Noida, Hyderabad, Gurugram, Kolkata, Pune 01 Apr, 2025

MNC- APPRENTICE TRAINEE PROGRAM! We are looking for Apprentice Trainees to join a leading organization for a 1-year apprenticeship program in Printing Technology - Installation,...
diplomagraduatediplomafresher

Sales Engineer
Appalto Electronics Private Limited 2.00 to 6.00 Years Indore,Other Madhya Pradesh 01 Apr, 2025

Skills: Technical knowledge, Communication skills, Problem-solving, Customer relationship management, Sales acumen, Presentation skills, Negotiation skills, Product knowledge, Sales & Marketing: ...
Communication skillsCustomer relationship managementSales acumenPresentation skillsNegotiation skillsProduct knowledgeTechnical knowledgeProblemsolvingPlanorganize sales strategySales of complete range of batching productsTo reach new customer a

Online Sales Marketing Manager
DAYA WORLDWIDE LIMITED 3.00 to 7.00 Years Indore,Other Madhya Pradesh 01 Apr, 2025

Company Description DAYA WORLDWIDE LIMITED is a prominent supplier of premium quality imported lighting and furniture, with multiple warehouses across India including Mumbai and Indore. Specializ...
Online Sales ManagementMarketing StrategyDigital MarketingSEOSEM

Robotics Trainer
Youngovator 2.00 to 6.00 Years Indore,Other Madhya Pradesh 01 Apr, 2025

Company Description Youngovator is Indias leading phygital community platform designed for young innovators. We focus on enhancing cognitive and social skills of children through engaging technol...
RoboticsElectronicsMechanical EngineeringProgramming LanguagesPythonROSCurriculum DesignEducational TechnologyMentoringCoachingTrainingCommunicationTeamwork

MNC Apprenticeship Trainee Program_ Freshers
RECRUDO LABS LLP 0.00 to 1.00 Years Hyderabad,Bangalore, Kochi, Noida, Gurugram, Kolkata, Pune 01 Apr, 2025

MNC- APPRENTICE TRAINEE PROGRAM! We are looking for Apprentice Trainees to join a leading organization for a 1-year apprenticeship program in Printing Technology - Installation,...
diplomagraduatediplomafresher

Area Sales Manager
Transformatrix Global Private Limited 6.00 to 11.00 Years Hyderabad 01 Apr, 2025

Were Hiring! Area Sales Manager (Electronic Components) Were looking for an Area Sales Manager to join our Hyderabad Office. This is an excellent opportunity for those who want to grow their car...
salesbusiness developmentindustrialelectronics

Debt Manager
Live Connections 3.00 to 7.00 Years Hyderabad 01 Apr, 2025

Description Job Requirements Job Title Collection Manager-BIL, Personal Loan and MBL Functio...
collections processcollection strategyrecovery managementconsumer debtcollection managementcollection systemsdebt collection

Freshers, Exp - Sales Associates - EV Charger Manufacturer
Avani Consulting 0.00 to 3.00 Years Gurugram 01 Apr, 2025

Greetings from Avani Consulting We are hiring for the below opportunity: Company: A leading EV charger manufacturer, revolutionizing the electric vehicle charging ecosystem. <...
sales coordinationchargerslithium-ion batteriesbattery

Marketing Executive
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Bhagalpur, Hyderabad, Pune, Patna, Guwahati 01 Apr, 2025

Marketing executives coordinate and oversee campaigns geared at promoting products, services, and causes. Marketing executives are adept at a variety of platforms, including print and social med...
marketing researchmarketing communicationmarketing managementbrand managementmarketing

Hiring For Online Marketing Executive (Work From Home Or Office Both) DELHI-NCR
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 01 Apr, 2025

Dear Candidate Greetings fromDesnor Destination Pvt Ltd ! Job Summary Idealises Internet Marketing Agency is looking for Marketing Executive to join our dynamic team and embark on a rewarding...
marketing planningdigitaldisplay advertisingmarketingfreelancingwork from homemarketing communicationpart time

Brand Manager
MNR Solutions Pvt Ltd 10.00 to 16.00 Years Gurugram 01 Apr, 2025

Brand Manager Key Responsibilities: Develop and execute comprehensive brand strategies and marketing plans, collaborating with the founders to drive brand growth and strengthen market presence...
brand managementbrand marketingbrand planningbrand campaigns

Junior IoT Hardware and Firsm ware Developer @Amritapuri
Amrita Vishwa Vidyapeetham 2.00 to 6.00 Years Kollam,Other Kerala 01 Apr, 2025

Job Title Junior IoT Hardware And Firsm ware Developer Required Number 1 Qualification B.Tech, Good to have M.Tech but not a must to have requirement Job Description Tranquility IoT & Big Data Sol...
Electronics design skillsknowledgeKnowhow of embedded codingAbility to think out of the box

PCB Layout Design Engineer
RIOD LOGIC PRIVATE LIMITED 2.00 to 6.00 Years Kochi,Other Kerala 01 Apr, 2025

Job Overview: A PCB Layout Design Engineer is responsible for designing and developing printed circuit board (PCB) layouts to meet electrical, mechanical, and manufacturing requirements. The role...
PCB designAltium DesignerCadence AllegroOrCADSignal integrityPower integrityThermal analysisBill of MaterialsDFMDFT3D modelingPower distributionPCB layoutMentor GraphicsGerber filesIPC standardsEMIEMC guidelinesDesign reviewsRF PCB layou

Hotel cashier
Addon Jobs 2.00 to 6.00 Years Kochi,Other Kerala 01 Apr, 2025

Welcoming customers, answering their questions, helping them locate items, and providing advice or recommendations. Candidate will needed cashier experience for hotel field. Operating scanners, ...
Cashiering

Sales and Service executive
Labmatrix Instrument India Pvt Ltd 2.00 to 6.00 Years Chandigarh 01 Apr, 2025

Company Description Labmatrix is a pioneer in multi-vendor services, laboratory instrument supplier, consultancy and training in analytical scientific domain. Role Description Sales and Service...
SalesCustomer ServiceTechnical SupportCommunication

Sales Manager South AND West
EMPLOYMENT AGENCY 5.00 to 10.00 Years Bhopal,Ahmedabad, Bangalore, Chennai, Hyderabad, Mumbai City 01 Apr, 2025

Job Title: Sales Manager (South or West India) Location: Work from Home Working Days: Monday to Saturday Working Hours: 9:3...
team leadingconsumer goodsfield sales

Solar Service Executive - Pune,Ahmedabad, Raipur.
PRIMATE CONSULTING SERVICES PRIVATE LIMITED 1.00 to 6.00 Years Ahmedabad,Raipur, Pune 01 Apr, 2025

Job TiTle :Solar Service Executive Location- Pune,Ahmedabad, Raipur. Must Have: Bike and DL Job Specification

Reports to Regio...
solarbikes

QC Inspection
Dhruv Corporate (HR) Solutions Pvt Ltd 3.00 to 5.00 Years Ahmedabad 01 Apr, 2025

Job Title: QC Inspector Job Description: The QC Inspector will be responsible for performing quality che...
defect identificationqc inspectionquality controlheavy fabricationquality assuranceprocess improvementproduct inspectioncompliance with industry standardsdispatch documentation

Inside Sales Executive
Vishal Consultancy 1.00 to 4.00 Years Ahmedabad 01 Apr, 2025

Designation: Inside Sales Executive Education: ITI/Diploma/BE: Electrical, Electronics, Mechatronics, Instrumentation MBA, B. Com with good experience and good communication skill Experience: ...
electronicssales

MNC Apprenticeship Trainee Program_ Freshers
RECRUDO LABS LLP 0.00 to 1.00 Years Pune,Bangalore, Kochi, Noida, Hyderabad, Gurugram, Kolkata 28 Mar, 2025

MNC- APPRENTICE TRAINEE PROGRAM! We are looking for Apprentice Trainees to join a leading organization for a 1-year apprenticeship program in Printing Technology - Installation,...
diplomagraduatediplomafresher

Assistant Manager - Operations
BN Recruitment Services Hiring For Banking 2.00 to 7.00 Years Hyderabad,Bangalore, Chennai, Other Tamil Nadu, Other Andhra Pradesh, Pondicherry, Vishakhapatnam, O 28 Mar, 2025

Job brief We are looking for a responsible Assistant Manager to help organize and run our retail stores and fill in for thewhen needed. Your job will be highly important in ensuring the sales...
back office operationsteam handlingoperationscommunication skills

Sales Development Manager-Banca channel- HDFCLIFE
HFDC Life Insurance Company Limited 1.00 to 2.00 Years Hyderabad 28 Mar, 2025

Job description Role & responsibilities

Developing and implementing sales strategies to meet sales targets for life insurance products.

Ach...
salesrelationship managementbusiness developmentfield sales

MNC Apprenticeship Trainee Program_ Freshers
RECRUDO LABS LLP 0.00 to 1.00 Years Gurugram,Noida, Bangalore, Kochi, Hyderabad, Kolkata, Pune 28 Mar, 2025

MNC- APPRENTICE TRAINEE PROGRAM! We are looking for Apprentice Trainees to join a leading organization for a 1-year apprenticeship program in Printing Technology - Installation,...
diplomagraduatediplomafresher

Electronics Service Engineer
BIZZHYPE ENTERPRISES 2.00 to 5.00 Years Gurugram 28 Mar, 2025

JOB DESCRIPTIONS 1. Education: Diploma/BE Electronics/Instrumentation/ from a reputed college/ university. 2. Experience: At least 2 years of relevant experience. solderingelectronics engineeringinstrumentation engineeringinstallationtroubleshootingtesting

Autocad Draftsman
MNR Solutions Pvt Ltd 1.00 to 6.00 Years Delhi 28 Mar, 2025

2. AutoCAD Draftsman/ Assistant Design Engineer
Experience: 1 to 3 years in Audiovisual AutoCAD Drawing Qualification- 3 Years Diplo...
autocad draftingdesign engineeringautocadvisiorevit

Field Sales Engineer
Job Drive HR Consultants Hiring For confidential 8.00 to 13.00 Years Delhi,Noida, Bangalore, Hyderabad, Gurugram, South Goa, North Goa, Pune, Mumbai City, Ahmedabad 28 Mar, 2025

Job Title: Field Sales Engineer/ Manager Location:Bangalore/Pune/Faridabad/Gurgaon/Vizaq/Hyderabad /Delhi/Goa/ Ahmedabad Noida...
sales engineeringindustrial salesindustrial products

Assistant Manager - Operations
BN Recruitment Services Hiring For Banking 2.00 to 7.00 Years Chennai,Pondicherry, Other Tamil Nadu, Bangalore, Hyderabad, Other Andhra Pradesh, Vishakhapatnam, O 28 Mar, 2025

Job brief We are looking for a responsible Assistant Manager to help organize and run our retail stores and fill in for thewhen needed. Your job will be highly important in ensuring the sales...
back office operationsteam handlingoperationscommunication skills

Urgent hiring for Electronics Engineer Fresher
Karnataka Information Solution 0.00 to 4.00 Years Chennai,Bangalore, Hyderabad 28 Mar, 2025

Job Description Electronics Engineer Educational Qualification: BE / B.Tech in Electronics Job Types : Fresher, Experienced Salary : Rs.25,000/- to 50,000/- Key Responsibilities: Testing of E...
semiconductor manufacturingtestingequipment manufacturingups systemsembedded programmingelectronics engineeringautomation testing

Field Sales Engineer
Job Drive HR Consultants Hiring For confidential 8.00 to 13.00 Years Pune,Bangalore, Noida, Hyderabad, Gurugram, South Goa, North Goa, Mumbai City, Delhi, Ahmedabad 24 Mar, 2025

Job Title: Field Sales Engineer/ Manager Location:Bangalore/Pune/Faridabad/Gurgaon/Vizaq/Hyderabad /Delhi/Goa/ Ahmedabad Noida...
sales engineeringindustrial salesindustrial products

Adaptive AUTOSAR & SOVD Technical Lead
Best Infosystems Ltd 7.00 to 12.00 Years Pune 24 Mar, 2025

Adaptive AUTOSAR & SOVD Technical Lead_Full Time_Pune Job Title: Adaptive AUTOSAR & SOVD Technical Lead Job Type: Full Time Experience: 7- 14 years Location: Pune Your Tasks: 1.Build and lead s...
technicalautosaradaptiveintegrating matlab/simulinkleadc/c

PREV
NEXT

consumer electronics Job Openings

Description Job Requirements Job Title Collection Manager-BIL, Personal Loan and MBL Functio... collections processcollection strategyrecovery managementconsumer debtcollection managementcollection systemsdebt collection

Job brief We are looking for a responsible Assistant Manager to help organize and run our retail stores and fill in for thewhen needed. Your job will be highly important in ensuring the sales... back office operationsteam handlingoperationscommunication skills

2. AutoCAD Draftsman/ Assistant Design Engineer

Job brief We are looking for a responsible Assistant Manager to help organize and run our retail stores and fill in for thewhen needed. Your job will be highly important in ensuring the sales... back office operationsteam handlingoperationscommunication skills

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Description Job Requirements Job Title Collection Manager-BIL, Personal Loan and MBL Functio...
collections processcollection strategyrecovery managementconsumer debtcollection managementcollection systemsdebt collection

Job brief We are looking for a responsible Assistant Manager to help organize and run our retail stores and fill in for thewhen needed. Your job will be highly important in ensuring the sales...
back office operationsteam handlingoperationscommunication skills

Job brief We are looking for a responsible Assistant Manager to help organize and run our retail stores and fill in for thewhen needed. Your job will be highly important in ensuring the sales...
back office operationsteam handlingoperationscommunication skills