Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
JobDescription : The Role: Web developer The Location: Hyderabad, India The Team: The resource would be a part of the Market Data Marketing Systems technology team. He /She would be a part of the exis...
aws elasticsearch java spring analytics dataflow opensource marketdata webservices websolutions solutiondelivery performancetuning clientrequirements technicalleadership requirementsgathering databasesupport it qa xml tatementsofworksowECM Solution Delivery manager - Documentum management Job Description Role Purpose: Define and implement document/ content man- agement roadmap, including required resources and investment plan Man...
net haredservices contentmanagement qualitystandards lifesciences solutiondelivery computerscience costeffective customerrelations userexperience solutiondesignJobDescription : The Role: Web developer The Location: Hyderabad, India The Team: The resource would be a part of the Market Data Marketing Systems technology team. He /She would be a part of the exis...
aws elasticsearch java spring analytics dataflow opensource marketdata webservices websolutions solutiondelivery performancetuning clientrequirements technicalleadership requirementsgathering databasesupport it qa xml tatementsofworksowJobDescription : The Role: Web developer The Location: Hyderabad, India The Team: The resource would be a part of the Market Data Marketing Systems technology team. He /She would be a part of th...
aws elasticsearch java spring analytics dataflow opensource marketdata webservices websolutions solutiondelivery clientrequirements technicalleadership requirementsgathering tatementsofw ksow databaSolution Architect / Specialist Java (Full Stack) Talent Toppers Solution Architect / Specialist Java (Full Stack) Experience : 8 to 12 years Job Summary The Specialist is regarded as the Subject ...
java delivery customerrelations sales environment softwaredevelopmentlifecycle gapanalysis problemsolving computerscience solutiondelivery problemresolution agilemethodologies softwaredevelopment javaRequisition Title : MS Excel Analyst Division : ISBL Demand Type : Contract Skills : MS Excel VBA Skill, Excel with Marcos Experience Required : 2 - 6 years Relevant Experience Required : 2 - 4 years ...
scripts excel analysis design vba testing communication maintenance olutionsdesign businesssolutiondelivery communicationskills technologysolutiondelivery solutionoriented solutiondelivery enterprisesolutiondesignJobDescription : S&P Global Platts The Role : Lead Software Developer Dot Net The Location : Hyderabad Grade: 11A The Team : The resource would be a part of the Market Data Marketing S...
dataflow opensource marketdata clientside unittesting equipmentsupply solutiondelivery clientrequirements technicalleadership dependencyinjection olymerasechainreactionpcr ejava netframewWe are now looking for a Veeva MyInsights Engineer to further exploit Veeva and Salesforce platforms to amplify medical representative impact and field force productivity and drive organizati...
customerrelationshipmanagement solutiondelivery projectmanagement capacitymanagement technicalleadership customerrelationship businessrequirements tatementsofw ksow ganizationdesign globaltransf mationJobDescription : S&P Global Platts The Role : Lead Software Developer Dot Net The Location : Hyderabad Grade: 11A The Team : The resource would be a part of the Market Data Marketing S...
dataflow opensource marketdata clientside unittesting equipmentsupply solutiondelivery clientrequirements technicalleadership dependencyinjection olymerasechainreactionpcr ejava netframewBusiness Unit: IT Product Delivery Reporting to: VP Product Delivery Location: Vashi , Navi Mumbai Head Mobile Application Job Description Qualifications: Essential : Bachelor s Degree in Comput...
lifecycle userexperience computerscience projectexecution analyticalskills solutiondelivery mobiledevelopment androiddevelopment communicationskills pr java perf mancemetrics inf mationtechnologyBusiness Development Trainee Trace Systems is looking for a dynamic Business Development Trainee to build and manage the Source Trace business development function in the Agriculture domain in India. ...
servicelevel salescommission solutiondelivery marketingstrategy businessdevelopment communicationskills customersatisfaction agri sales trace salary mobile training business strategy planning teamwork prospect marketing levelJobDescription : S&P Global Platts The Role : Lead Software Developer Dot Net The Location : Hyderabad Grade: 11A The Team : The resource would be a part of the Market Data Marketing S...
dataflow opensource marketdata clientside unittesting equipmentsupply solutiondelivery clientrequirements technicalleadership dependencyinjection olymerasechainreactionpcr ejava netframewSoftware testing is at the heart of quality assurance and a critical element in the solution delivery process. Professionals within the testing specialty focus on the use of methodologies and techniqu...
testcases regressiontesting automation java softwaretesting qualityassurance solutiondelivery testing software business assurance maintenance HardwareTesting AutomatedSoftwareTesting Retesting Software ep tingJobDescription : S&P Global Platts The Role : Lead Software Developer Dot Net The Location : Hyderabad Grade: 11A The Team : The resource would be a part of the Market Data Marketing S...
dataflow opensource marketdata clientside unittesting equipmentsupply solutiondelivery clientrequirements technicalleadership dependencyinjection olymerasechainreactionpcr ejava netframewIn this position, you will get to: Design Build: Be responsible for designing, developing and deploying solutions that will include EAI, API, ETL and EDI Work with end users, IT business analysts...
datastandards datacollection servicecatalog computerscience equipmentsupply solutiondelivery datacommunication deliveringsolutions businessrequirements designspecifications enterprise nf mationtechnologyThe Java Business Rules Developer is responsible for designing, developing, and authoring Drools rules engines for the clients specific insurance business line. The position will work on task level su...
microsoftsqlserver javaee sqlserver businessrules systemanalysis solutiondelivery rdlinesupp object ienteddesign javaenterpriseedition rulesengines revenuecycle externalclients kingexperience technicaladvisThe Java Web Application Developer will assist the solution delivery team in the development and delivery of next generation Revenue Cycle Management and Health Informatics applications. The job dutie...
microsoftsqlserver revenuecyclemanagement javaee sqlserver uidevelopment systemanalysis webapplication webapplications solutiondelivery rdlinesupp object ienteddesign revenuecycle externalclients softwareanalysisSenior DevOps Engineer Job ID IT JOBS#221 Location: Chennai/ Bangalore/ Delhi NCR Required Skills: Our client is the first RCM specialist in the Middle East. The company has always been one step ahea...
automation jenkins idevelopment itleadership teammanagement configurationmanagement performa lifecycle solutiondelivery microsoftsqlserver webapplication javaee sqlserver agiledevelopment objectorienteddesignPosition Purpose & Summary The Full Stack Engineer is responsible for design and development of automation frameworks, accelerators and tools in various areas of the Global IT Project. This...
testcases opensource productquality testautomation solutiondelivery agileenvironment mobiledevelopment softwareengineering programminglanguages continuousintegration utomationframew ksResponsibilities: Conceive and implement a technology solution that meets both the needs of the business and aligns with the overall IT strategy and vision Liaise between Client colleagues, analysts...
java delivery customerrelations sales environment itstrategy visualaids datamodels drivechange musicmaking businessprocess qualityassurance solutiondelivery highavailability mod tatementsofw ksowShieldSquare is looking for Sales Engineers who will work in hand with the Sales team to technically qualify, solution the product and close business. The person will need to pitch in where ever neede...
sales marketing target businessdevelopment insurance webservices solutiondelivery presentationskills technicalleadership ip dns cloud video email proof cookies security prospect openness pnetw kingATG Analyst Position: ATG Analyst Overall Experience: 6 Years Relevant Experience: Experience in Endeca as well No. of position: 1 Location: Bangalore Understand the business capabilities of AT...
handlemultipleprojectsenvironmentalimpactassessmentroadmapscodereviewdetaildesignqualitycontrolproblemsolvingriskmitigationcodingstandardssolutiondeliveryserstiesoughresearchknowleResponsibilities Ensures satisfactory solution delivery (product+services) Maintains broad technology awareness - web, mobile and cloud Is proficient in Manual/ Automation testing - Web & Mobile A...
salescustomerservicecustomerrelationsmarketingonboardingbugtrackingtoolbugtrackingservicelevelclientdeliverysecuritytestingsolutiondeliveryautomationtestingaccountmanagementerfmancetestingJobDescription : S&P Global Platts The Role : Lead Software Developer Dot Net The Location : Hyderabad Grade: 11A The Team : The resource would be a part of the Market Data Marketing S...
dataflowopensourcemarketdataclientsideunittestingequipmentsupplysolutiondeliveryclientrequirementstechnicalleadershipdependencyinjectionolymerasechainreactionpcrejavanetframewSolution Delivery Expert- ServiceNow integration & Assurance Job Description Manage the planning, design and build of IT assurance solutions, based on specifications, while meeting quality and perfo...
coeslasdesignserexperiencecapacityplanningsolutiondeliverycostefficiencysolutiondesignprojectmanagementbusinessrequirementsqualitystandardsqualitymanagementcosteffectiveJobDescription : S&P Global Platts The Role : Lead Software Developer Dot Net The Location : Hyderabad Grade: 11A The Team : The resource would be a part of the Market Data Marketing S...
dataflowopensourcemarketdataclientsideunittestingequipmentsupplysolutiondeliveryclientrequirementstechnicalleadershipdependencyinjectionolymerasechainreactionpcrejavanetframewBusiness Unit: IT Product Delivery Reporting to: VP Product Delivery Location: Vashi , Navi Mumbai Head Mobile Application Job Description Qualifications: Essential : Bachelor s Degree in Comput...
lifecycleuserexperiencecomputerscienceprojectexecutionanalyticalskillssolutiondeliverymobiledevelopmentandroiddevelopmentcommunicationskillsjavaperfmancemetricsinfmationtechnologyResponsibilities: Conceive and implement a technology solution that meets both the needs of the business and aligns with the overall IT strategy and vision Liaise between Client colleagues, analysts...
javadeliverycustomerrelationssalesenvironmentitstrategyvisualaidsdatamodelsdrivechangemusicmakingbusinessprocessqualityassurancesolutiondeliveryhighavailabilitymodtatementsofwksowDear Candidate, This is to inform you regarding the Job Opportunity with one of leading IT Company, here I am sharing you some basic details. Also requesting you fill the below required details to pr...
sapaccountingsapfunctionalconsultancystronginterpersonalskillscontinuousimprovementfacilitationsapfidatamodelssapsolutionssolutiondeliverysapconfigurationdercontrolnetwkingskills Immediate need for SCCM Admin for one of our Top Most MNC client;
Exp : 8+yrs
Relevant Exp: 3+yrs
Work Location: Bangalore.
Role/ Deliverables :
About the Team: Advanced Analytics team focuses on identifying, creating and deploying advanced analytics solutions across Numerify customer- base while also managing the strategic roadmap of advanc...
machinelearningpythondataanalysissqlanalyticsdataminingopensourcetextminingcustomerservicecomputersciencesolutiondeliveryigdatausecasesdatascienceemergingtrendsagilemethodologyManage the planning, design and build of IT solutions, based on functional specifications, while meeting quality and performance requirements and technical constraints. Manage the scheduling and deplo...
sharedservicesuserexperiencesolutiondesignqualitystandardssolutiondeliverydesigntestingenglishsecurityosteffectiveinfmationtechnologyfunctionalspecificationsstreamsbusinessplanningsched
Location: Bangalore/Noida
Gender : Male / Female Industry : IT Role & Responsibilities : Software design , development , testing and deployment of system application. Support the team on the different stages of system deve...
logisticsmicrosoftofficemvctestcasessystemdesignwebdevelopmentwebapplicationsolutiondeliveryrmycustomersuppstatementsofwksowlifecyclesoftwaredesignsystemdevelopmentapplicationsuWork together with the IT Service Management team to define, analyze, and document user technical requirements for workflow and screen form configuration of ServiceNow modules. Use the built-in tools ...
javamysqljsphibernatespringitservicemanagementwebservicescomputerscienceassetmanagementmediamanagementchangemanagementsolutiondeliveryservicemanagementproblemmanagementtatementsofwksowservicecatalogDirect responsibility for managing partner enablement for enterprise Customers Co- ordinate with internal teams for solution delivery (PS, Automation, Product Management and Operations) Goal is two- f...
budgetingmanagementoperationsautomationprojectdeliverysolutiondeliveryproductmanagementdeliverymanagementtwitterbusinesskshopsenterpriseenablementprofessionalservicesRoles and Responsibilities- Person should have direct experience of managing delivery of reasonably complex and large programs, customer relationships, lead delivery and account strategy and planning ...
testingstrategymanagementintelligencesolutiondeliveryeviewsplanningattritionleadershipperspectiveslargeprograms
Job Details:Work with Digital team to understand the business needs and establish deep understanding of the business functions. Work with Business unit SMEs to establish deep understanding of the busi...
ApplicationDesignSolutionDeliveryArchitectureSoftwareDevelopmentProductDesignITManagementBusinessModelingrontEndSolutionFeasibilityAnalysisChangeControl© 2019 Hireejobs All Rights Reserved