engagement parties jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

engagement parties Job Openings

Showing 5101 - 5150 of 11815 Jobs

Female Fresher School Teacher in DPS Public School

RENOVISION TECHNOLOGY 0.00 to 1.00 Years Hyderabad,Bangalore, Cuttack, Amritsar, Jalandhar, Pune, Delhi, Dalhousie, Vadodara, Guwahati 01 Apr, 2025

Key Responsibilities:

teacher training

educational consulting

Account Management Director

SPENTO PAPERS (INDIA) LLP 12.00 to 22.00 Years Hyderabad,Bangalore, Noida, Chennai, Gurugram, Kolkata, Pune, Tadepalligudem, Mumbai City, Delhi 01 Apr, 2025

Management Representative

ALTSEO PRIVATE LIMITED 15.00 to 25.00 Years Hyderabad,Bangalore, Chennai, Bhagalpur, Kolkata, Gurugram, Mumbai City, Delhi, Anantpur, Ahmedabad 01 Apr, 2025

Pre Sales Executive

DIGITALCUBE CONSULTANCY SERVICES PRIVATE LIMITED 1.00 to 3.00 Years Hyderabad,Delhi 01 Apr, 2025

Designation:

Experience Required:

Location: presalestele sales

Business Development Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 8.00 to 12.00 Years Hyderabad,Bangalore, Noida, Chennai, Gurugram, Pune, Mumbai City, Delhi 01 Apr, 2025

Key Responsibilities:

Strategic Planning: Develop and execute strategic business development plans that align with company goals and target ma...
sales growthanalysismarket analysisadaptabilityadministration workmarketcommunicationstrategic planningstrategic thinkinginnovationnegotiationcontractsresearch

Nurse Practitioner Opening
Divya Staffing Solution 0.00 to 2.00 Years Gwalior,Indore, Bhopal, Jabalpur, Jaipur, Navi Mumbai, Kolkata, Pune, Mumbai City, Ahmedabad 01 Apr, 2025

The clinical research associate will manage multiple aspects of the subjects welfare. You will conduct regular site visits, generate and distribute internal and external newsletters, prepare fin...
healthcarenursingpharmacovigilancepharmaceutics

Chat Support Executive
JDM CONSULTANCY 1.00 to 5.00 Years Gurugram,Delhi 01 Apr, 2025

Dear Candidate, We have Urgent Hiring for Chat Executive in IGT Solutions : Roles and Responsibilities : _Develop and implement e-commerce st...
chat processnon voicecustomer servicebpoemailemail processchatbackend operations

Sr HRBP Associate -Gurugram
MEGMA SERVICES 3.00 to 6.00 Years Gurugram 01 Apr, 2025

Leading engineering and construction company requires Sr HRBP Associate - Gurugram One of our client luxury brand which is Indias leading manufacturer of premium doors, windows, wood house and t...
hr operationshrbpassociate

Marketing Executive
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Bhagalpur, Hyderabad, Pune, Patna, Guwahati 01 Apr, 2025

Marketing executives coordinate and oversee campaigns geared at promoting products, services, and causes. Marketing executives are adept at a variety of platforms, including print and social med...
marketing researchmarketing communicationmarketing managementbrand managementmarketing

Hiring For Online Marketing Executive (Work From Home Or Office Both) DELHI-NCR
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 01 Apr, 2025

Dear Candidate Greetings fromDesnor Destination Pvt Ltd ! Job Summary Idealises Internet Marketing Agency is looking for Marketing Executive to join our dynamic team and embark on a rewarding...
marketing planningdigitaldisplay advertisingmarketingfreelancingwork from homemarketing communicationpart time

Account Management Director
SPENTO PAPERS (INDIA) LLP 12.00 to 22.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Tadepalligudem, Mumbai City 01 Apr, 2025

We are seeking an experienced Account Management Director to lead and optimize our Account Management team. This leadership role will focus on driving customer success and revenue growth, ensuri...
medicaresalesservicemedicaidcustomerbusinessdevelopmentoversightprocessimprovement

Chief Talent Officer
SPENTO PAPERS (INDIA) LLP 25.00 to 0.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Itanagar 01 Apr, 2025

We are looking for a Chief Talent Officer who will support our talent acquisition and development activities. You will implement regular performance evaluations and be in charge of our employees...
engagementeeosystemhrispayrolldevelopmentorganizationplanningemployeesuccessionexcellentworkforceinterpersonalstrategic

Management Representative
ALTSEO PRIVATE LIMITED 15.00 to 25.00 Years Gurugram,Delhi, Bangalore, Chennai, Bhagalpur, Hyderabad, Kolkata, Mumbai City, Anantpur, Ahmedabad 01 Apr, 2025

Managers ensure that their assigned department, store, or district is well staffed and provisioned, adheres to quality and service standards, increases revenue and market share, and helps the bus...
qualitycollaborationdecision-makingmanagementcommunicationleadershipproblemsolvingdelegationproject

Business Development Manager
ADITYA BIRLA SUN LIFE INSURANCE COMPANY LIMITED 1.00 to 2.00 Years Gurugram,Delhi, Faridabad, Ghaziabad 01 Apr, 2025

Designation:Agency Manager Education:Any Graduates Experience:Fresher with Good network / Min. 1 Yearin anyDomain Sal...
salesinsuranceagency channelbfsi sales

Brand Manager
MNR Solutions Pvt Ltd 10.00 to 16.00 Years Gurugram 01 Apr, 2025

Brand Manager Key Responsibilities: Develop and execute comprehensive brand strategies and marketing plans, collaborating with the founders to drive brand growth and strengthen market presence...
brand managementbrand marketingbrand planningbrand campaigns

NTT DATA Virtual Drive Hedge Fund Gurgaon
NTT DATA INFORMATION PROCESSING SERVICES PRIVATE LIMITED 1.00 to 3.00 Years Gurugram 01 Apr, 2025

NTT DATA is Hiring experienced candidates for Hedge Fund Accounting domain. Location:Gurgaon Sector 48 (Candor Techspace) Work from Office Only Shift ...
reconciliationhedge fundsnav calculationinvestment banking

Business Development Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 8.00 to 12.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 01 Apr, 2025

Key Responsibilities:

Strategic Planning: Develop and execute strategic business development plans that align with company goals and target ma...
sales growthanalysismarket analysisadaptabilityadministration workmarketcommunicationstrategic planningstrategic thinkinginnovationnegotiationcontractsresearch

E2E CNX Architect / CNX Solution Architect
Infosys Limited 4.00 to 8.00 Years Other Kerala,Thiruvananthapuram 01 Apr, 2025

Key Responsibilities: A day in the life of an Infoscion As part of the Infosys consulting team your primary role would be to lead the engagement effort of providing high quality and value adding...
AWSDevOpsGoogle Cloud PlatformKubernetesTelecomSDLCAgile MethodologiesProject ManagementTeam ManagementAgile CoachBusiness Analyst

Creative Strategist
Samagra Progressive Learning Solutions Pvt Ltd 2.00 to 6.00 Years Kochi,Other Kerala 01 Apr, 2025

Samagra Progressive Learning Solutions Private Ltd is the brainchild of Madhu Bhaskaran, a renowned Business Strategist and HRD trainer. We aim to create a sense of total revamping in the lives of...
Market ResearchContent CreationCommunity EngagementCampaign ManagementBrand AwarenessLead GenerationVideo ProductionSocial Media StrategySocial Media Analytics

Outreach Officer
Malaibar Foundation for Research and Development 1.00 to 5.00 Years Kozhikode,Other Kerala 01 Apr, 2025

Company Description Malaibar Foundation for Research and Development is a non-profit organization dedicated to Research, Training, Publication, and Heritage Preservation in various core areas. Th...
Community EngagementCommunity OutreachCommunicationEvent ManagementResearchInterpersonal Skills

Creative Content Creator & Presenter
Royal Trading Co (Utsav) 2.00 to 6.00 Years Kochi,Other Kerala 01 Apr, 2025

We are looking for a female Content Creator & Presenter to develop, present, and publish engaging video content across social media platforms. The ideal candidate should have a strong on-camera ...
Content CreationVideo EditingSocial MediaCreativityStorytelling

Audit Manager
M/S B NANDI 14.00 to 24.00 Years Delhi,Noida, Oman, Itanagar, South America, Saudi Arabia, Kuwait, Mauritius, Bangalore, Philippines, 01 Apr, 2025

We are looking for an organized, analytical auditor to help us examine our current policies and procedures and help us develop strategies to improve our internal control systems. The Auditor will...
examinationdocumentationinformation processingevaluationauditory processingreportinganalyze information

Female Fresher School Teacher in DPS Public School
RENOVISION TECHNOLOGY 0.00 to 1.00 Years Delhi,Bangalore, Cuttack, Hyderabad, Amritsar, Jalandhar, Pune, Dalhousie, Vadodara, Guwahati 01 Apr, 2025

Key Responsibilities:

teacher trainingeducational consultingteachingschool teacherteacherclass teacher

Administrative Manager
Institute of Selection 5.00 to 10.00 Years Delhi,Mathura, Agra 01 Apr, 2025

Job Title: Assistant ADMIN Manager Location: Chhata, Mathura Department: P&&A Reports To: P&&A Manager Salary: INR 30,000/- to 50,000/- Job Summary The Admin Manager is responsible for overseeing...
budgetprocurementnegotiationpricing strategycoordination

ICICI Bank Aspire Program
ICICI Bank Ltd 0.00 to 1.00 Years Delhi,Noida, Bangalore, Chennai, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City 01 Apr, 2025

About the Company ICICI Bank Ltd, is one of Indias leading private bank offering a wide range of financial services. Established in 1994, it is headquartered in Mumbai and has ...
salesrelationship managementmanagement

Account Management Director
SPENTO PAPERS (INDIA) LLP 12.00 to 22.00 Years Delhi,Noida, Bangalore, Chennai, Hyderabad, Gurugram, Kolkata, Pune, Tadepalligudem, Mumbai City 01 Apr, 2025

We are seeking an experienced Account Management Director to lead and optimize our Account Management team. This leadership role will focus on driving customer success and revenue growth, ensuri...
medicaresalesservicemedicaidcustomerbusinessdevelopmentoversightprocessimprovement

Chief Talent Officer
SPENTO PAPERS (INDIA) LLP 25.00 to 0.00 Years Delhi,Noida, Bangalore, Chennai, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City, Itanagar 01 Apr, 2025

We are looking for a Chief Talent Officer who will support our talent acquisition and development activities. You will implement regular performance evaluations and be in charge of our employees...
engagementeeosystemhrispayrolldevelopmentorganizationplanningemployeesuccessionexcellentworkforceinterpersonalstrategic

Management Representative
ALTSEO PRIVATE LIMITED 15.00 to 25.00 Years Delhi,Bangalore, Chennai, Bhagalpur, Hyderabad, Kolkata, Gurugram, Mumbai City, Anantpur, Ahmedabad 01 Apr, 2025

Managers ensure that their assigned department, store, or district is well staffed and provisioned, adheres to quality and service standards, increases revenue and market share, and helps the bus...
qualitycollaborationdecision-makingmanagementcommunicationleadershipproblemsolvingdelegationproject

Business Development Manager
ADITYA BIRLA SUN LIFE INSURANCE COMPANY LIMITED 1.00 to 2.00 Years Delhi,Faridabad, Ghaziabad, Gurugram 01 Apr, 2025

Designation:Agency Manager Education:Any Graduates Experience:Fresher with Good network / Min. 1 Yearin anyDomain Sal...
salesinsuranceagency channelbfsi sales

Business Development Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 8.00 to 12.00 Years Delhi,Noida, Bangalore, Chennai, Hyderabad, Gurugram, Pune, Mumbai City 01 Apr, 2025

Key Responsibilities:

Strategic Planning: Develop and execute strategic business development plans that align with company goals and target ma...
sales growthanalysismarket analysisadaptabilityadministration workmarketcommunicationstrategic planningstrategic thinkinginnovationnegotiationcontractsresearch

Product Manager
uEngage 3.00 to 7.00 Years Chandigarh 01 Apr, 2025

Role Overview We are seeking a dynamic and results-driven Product Manager to join our team in Chandigarh. As a Product Manager, you will own the product lifecycle, from ideation to execution, and...
Product ManagementMarket ResearchStakeholder ManagementQuality AssurancePerformance MonitoringUserCentered Design

Research Fellow
Cyber Security Academy Southampton 3.00 to 7.00 Years Chandigarh 01 Apr, 2025

Palliative Care Trial Southampton Clinical Trials Unit, Faculty of Medicine Overview Southampton Clinical Trials Unit (SCTU) is seeking a highly motivated Research Fellow join the INDIGO study ...
Qualitative researchData collectionData analysisWritten communicationOral communicationGood Clinical PracticeOrganisational skillsProblemsolvingPersonBased ApproachIntervention development

Inside Sales Executive
THE TALENT KEEPERS 1.00 to 5.00 Years Chandigarh,Mohali, Zirakpur, Ambala 01 Apr, 2025

URGENT HIRING! Profile-Inside Sales Location-Mohali Working Days-5 Days Working Hr - 7:30PM- 4:30PM, Night Shift (CABS ARE PROVIDED) Job Description: Utili...
international voice processvoice processlead generationinside salesinternational bpo

Audit Manager
M/S B NANDI 14.00 to 24.00 Years Chandigarh,Oman, Itanagar, South America, Saudi Arabia, Kuwait, Mauritius, Bangalore, Noida, Philipp 01 Apr, 2025

We are looking for an organized, analytical auditor to help us examine our current policies and procedures and help us develop strategies to improve our internal control systems. The Auditor will...
examinationdocumentationinformation processingevaluationauditory processingreportinganalyze information

TechOps-DE-CloudOpsAMS-GW PC Developer-Manager
EY 9.00 to 13.00 Years Coimbatore,Other Tamil Nadu 01 Apr, 2025

At EY, youll have the chance to build a career as unique as you are, with the global scale, support, inclusive culture and technology to become the best version of you. And were counting on your u...
Business communicationLeadershipService managementChange managementIncident managementProblem managementRelease managementInsurance domainPropertyCasualtySoftware development best practicesClient facing experience

Journalist
ThroughBit 0.00 to 3.00 Years Coimbatore,Other Tamil Nadu 01 Apr, 2025

Education - Bachelors degree in Journalism, Communications, or a related field. Experience 0 2 Years Key Responsibilities: Gather real-time information from industry experts, events, and exte...
JournalismMass CommunicationCryptocurrencyWritingEditingVerbal CommunicationNews ReportingStorytellingInterpersonal SkillsNetworkingWeb3Blockchain TechnologyDecentralised Applications

Brand Ambassador
The Ripples 0.00 to 4.00 Years Coimbatore,Other Tamil Nadu 01 Apr, 2025

Ripples Internship Opportunity Be a Brand Ambassador! About Ripples At Ripples, we innovate, ideate, and create Next Gen Leaders. We believe in people, and thats how our thriving community of 1...
Community EngagementEvent Management

Human Resources
DIRAA HR SERVICES Hiring For our clients 0.00 to 4.00 Years Coimbatore 01 Apr, 2025

We are looking for an experienced HR Manager to oversee recruitment, employee relations, performance management, and compliance with labor laws. This role will also be responsible for fostering a...
talent acquisitionrecruitmentsourcing

Audit Manager
M/S B NANDI 14.00 to 24.00 Years Chennai,Oman, Itanagar, South America, Saudi Arabia, Kuwait, Mauritius, Bangalore, Noida, Philippine 01 Apr, 2025

We are looking for an organized, analytical auditor to help us examine our current policies and procedures and help us develop strategies to improve our internal control systems. The Auditor will...
examinationdocumentationinformation processingevaluationauditory processingreportinganalyze information

Regional Sales Manager-Project sales( construction chemicals)
MEGMA SERVICES 12.00 to 20.00 Years Chennai,Bangalore, Hyderabad 01 Apr, 2025

Global construction chemical brand requires Regional sales Mgr ( Project sales)- Bangalore /Chennai/Hyderabad One of our client aGlobal construction chemical MNC aa 100% subsidiary o...
project sales headconstruction chemical sales

Account Management Director
SPENTO PAPERS (INDIA) LLP 12.00 to 22.00 Years Chennai,Bangalore, Noida, Hyderabad, Gurugram, Kolkata, Pune, Tadepalligudem, Mumbai City, Delhi 01 Apr, 2025

We are seeking an experienced Account Management Director to lead and optimize our Account Management team. This leadership role will focus on driving customer success and revenue growth, ensuri...
medicaresalesservicemedicaidcustomerbusinessdevelopmentoversightprocessimprovement

Chief Talent Officer
SPENTO PAPERS (INDIA) LLP 25.00 to 0.00 Years Chennai,Bangalore, Noida, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City, Delhi, Itanagar 01 Apr, 2025

We are looking for a Chief Talent Officer who will support our talent acquisition and development activities. You will implement regular performance evaluations and be in charge of our employees...
engagementeeosystemhrispayrolldevelopmentorganizationplanningemployeesuccessionexcellentworkforceinterpersonalstrategic

Management Representative
ALTSEO PRIVATE LIMITED 15.00 to 25.00 Years Chennai,Bangalore, Bhagalpur, Hyderabad, Kolkata, Gurugram, Mumbai City, Delhi, Anantpur, Ahmedabad 01 Apr, 2025

Managers ensure that their assigned department, store, or district is well staffed and provisioned, adheres to quality and service standards, increases revenue and market share, and helps the bus...
qualitycollaborationdecision-makingmanagementcommunicationleadershipproblemsolvingdelegationproject

Business Development Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 8.00 to 12.00 Years Chennai,Bangalore, Noida, Hyderabad, Gurugram, Pune, Mumbai City, Delhi 01 Apr, 2025

Key Responsibilities:

Strategic Planning: Develop and execute strategic business development plans that align with company goals and target ma...
sales growthanalysismarket analysisadaptabilityadministration workmarketcommunicationstrategic planningstrategic thinkinginnovationnegotiationcontractsresearch

Digital Marketing Specialist
Inovlyst Solutions Pvt Ltd 2.00 to 6.00 Years Bhopal,Other Madhya Pradesh 01 Apr, 2025

Company Description Inovlyst Solutions Pvt Ltd empowers businesses with innovative, scalable, and growth-driven IT solutions. Our goal is to ensure that technology works efficiently for your busi...
Social Media MarketingCommunication skillsDigital MarketingWeb AnalyticsAnalytical skillsOnline Marketing strategiesOrganizational skillsTimemanagement abilitiesWritten communication skills

Agency Manager - Health Insurance
Skill Sphere Placement Services Hiring For Niva Bupa Health Insurance 1.00 to 6.00 Years Bhopal,Ujjain, Indore, Jabalpur, Chhindwara, Raipur, Alwar, Ludhiana, Ambala, Raigarh 01 Apr, 2025

Profile: Unit Manager / Agency Manager / Business Development Manager Vertical : Agency CTC Offered :up to 4.5 LPA Incentives allowances agency channelinsurance salesgeneral insurancefield saleschannel partnershealth insuranceagency developmentbusiness development

Hr Executive
KONVERGE TECHNOLOGIES PVT LTD 2.00 to 4.00 Years Bangalore,Bangalore Rural 01 Apr, 2025

Oversee the end-to-end recruitment and selection process, including job postings, screening resumes, conducting interviews, and onboarding new hires to exit formalities.

Main...
onboardinghr generalist activitiesemployee engagementhr administrationpetty cashpayroll processingit recruitmentexit formalitiessourcing

Hr Recruiter
Unidus Services 0.00 to 4.00 Years Bangalore,Chennai, Noida, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City, Delhi, Port Blair 01 Apr, 2025

We are looking for an HR Non-IT Recruiter with experienc...
non it recruitmentrecruitmentscreening

Business Development Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 8.00 to 12.00 Years Bangalore,Noida, Chennai, Hyderabad, Gurugram, Pune, Mumbai City, Delhi 01 Apr, 2025

Key Responsibilities:

Strategic Planning: Develop and execute strategic business development plans that align with company goals and target ma...
sales growthanalysismarket analysisadaptabilityadministration workmarketcommunicationstrategic planningstrategic thinkinginnovationnegotiationcontractsresearch

Business Development Manager
MNR Solutions Pvt Ltd 3.00 to 8.00 Years Bangalore,Chennai 01 Apr, 2025

Roles & Responsibility: Develop and implement business development strategies to achieve company goals and objectives. Identify new market segments, emerging trends, and potent...
horeca salesbusiness-to-businessbusiness developmentsales

PREV
NEXT

engagement parties Job Openings

Key Responsibilities:

Key Responsibilities:

Key Responsibilities:

Key Responsibilities:

Key Responsibilities:

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers