financial process improve jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

financial process improve Job Openings

Showing 27401 - 27450 of 76520 Jobs

Customer Care Executive

Conneqt Business Solutions Limited 0.00 to 2.00 Years Hyderabad 01 Apr, 2025

Salary:

communication skills

flexible

Hospital Manager

RAV GLOBAL SOLUTIONS PRIVATE LIMITED 13.00 to 18.00 Years Hyderabad,Bangalore, Kochi, Chennai, Gurugram, Kolkata, Kollam, Thiruvanananthapuram, Mumbai City, D 01 Apr, 2025

International Voice Process

Tech Mahindra Ltd 1.00 to 6.00 Years Hyderabad 01 Apr, 2025

customer service

international bpo

Agency Development Manager

RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 0.00 to 4.00 Years Hyderabad 01 Apr, 2025

insurance agency management

channel partners

direct sales

agency sales

Requirement in Agency Development manager for Life Insurance CTc upto 5.5 lacs

ATS Infovision 3.00 to 8.00 Years Gwalior,Bhopal, Jabalpur, Solapur, Rajkot, Pune, Aurangabad, Surat, Nagpur 01 Apr, 2025

Dear Candidates,

Candidate Qualifications:

Previous Sales Experience: Proven success in a sales role, prefe...
agency developmentagent recruitmentunit manager

Procurement Assistant

SHARMA ENTERPRISES 1.00 to 6.00 Years Gwalior,Indore, Bhopal, Ernakulam, Kochi, Bokaro, Malappuram, Kozhikode, Thrissur, Ranchi 01 Apr, 2025

purchase operations

supplier quality assurance

Associat Customer Service

DREAMS SOLUTIONS 2.00 to 4.00 Years Gwalior,Ujjain, Indore, Pithampur, Khargone, Katni, Ratlam, Seoni, Sagar, Satna 01 Apr, 2025

cash transactions

service delivery

operations

customer service operations

banking

branch

cash handling

Product Manager

RAJPUT PROTECTION SERVICE PRIVATE LIMITED 15.00 to 25.00 Years Gwalior,Indore, Bhopal, Jabalpur, Ratlam, Sagar, Ernakulam, Pala, Wayanad, Thiruvananthapuram 01 Apr, 2025

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c...
product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing

Production Engineer

Garima Interprises 1.00 to 6.00 Years Gurugram,Delhi, Noida, Australia, Austria, Canada, Other AndamanNicobar, Port Blair, Bangalore, Chen 01 Apr, 2025

Production Engineer Job Description Template We are searching for a reliable, innovative production engineer to oversee manufacturing processe...
labordiagnosisreportingdocumentationcommunicationsafetyscheduling managementmanufacturing processes

Profiles to be source-Agency Direct - in Life Insurance

ATS Infovision 2.00 to 7.00 Years Gurugram,Dehradun 01 Apr, 2025

Dear Candidates Greetings of the Day, We are the leading Job Consultancy for BFSI Sector and have tieup with almost all major life Insurance companies for recruitment...
life insurancebusiness developmentagency developmentagency channelassociate development

Pipeline Engineer

Garima Interprises 1.00 to 6.00 Years Gurugram,Delhi, Noida, Australia, Austria, Canada, Other AndamanNicobar, Port Blair, Bangalore, Chen 01 Apr, 2025

Pipeline Engineer Job Description Template We are looking for a highly experienced pipeline engineer to design and develop a variety of pipeline...
budgetingblueprintcommunicationrepairconstruction technologytechnical standards

Ppc Head. .

Institute of Selection 10.00 to 12.00 Years Gurugram,Delhi 01 Apr, 2025

Opening for Freelance Recruiter with Talentsphere Management Services

Reema Rai 1.00 to 6.00 Years Gurugram,Delhi, Noida, Bangalore, Kochi, Chennai, Hyderabad, Kolkata, Mumbai City, Mangalore 01 Apr, 2025

Talentsphere Management Services!

fantastic opportunity

screening resumes

executive search

freelance recruitment

Telecaller

THE TALENT KEEPERS 2.00 to 7.00 Years Gurugram 01 Apr, 2025

URGENT HIRING !

Chat Support Executive

JDM CONSULTANCY 1.00 to 5.00 Years Gurugram,Delhi 01 Apr, 2025

Dear Candidate,

We have Urgent Hiring for Chat Executive in IGT Solutions :

Roles and Responsibilities :

Design Manager

SHARMA ENTERPRISES 3.00 to 8.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Guwahati 01 Apr, 2025

design patterns

strategic planning

technical documentation

supervisory skills

Cluster Head - ADRV Insurance Team Handling Profile Salary Upto 14Lac

Niyukti Management Consultants 10.00 to 17.00 Years Gurugram,Delhi, Noida, Lucknow, Pune, Mumbai City 01 Apr, 2025

Key Specifications:

insurance agency management

Urgent | Hiring SME(Ticketing) & SME (Sales) in Delhi & Gurugram

Sharda Consultancy Services 1.00 to 6.00 Years Gurugram,Delhi, Faridabad, Noida 01 Apr, 2025

subject matter expertise

Required Tele Caller Dayshift

Sharda Consultancy Services 0.00 to 2.00 Years Gurugram,Delhi, Noida 01 Apr, 2025

Required Female Tele Caller for outbound domestic process.

Mechanical Supervisor

Xperts Manpower Solutions Enterprises Hiring For Japanese MNC Fresher Gurugram,Delhi, Faridabad, Noida 01 Apr, 2025

machine shop

machine assembly

quality engineering

mechanical maintenance

mechanical engineering

assembly shop

process inspection

production engineering

Senior Quality Engineer

Xperts Manpower Solutions Enterprises Hiring For MNC Automotive Company 0.00 to 2.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida, Manesar, Kundli 01 Apr, 2025

mechanical engineering

audit documentation

production planning control

new product development

production engineering

quality control

thermoforming

production scheduling

Sr.Finance Manager

Confidential 10.00 to 15.00 Years Gurugram 01 Apr, 2025

We are Hiring for Senior Finance Manager - SahiBandhu FinTech Services ( The Manipal Group)

About Us:-

stakeholder management

erp software

Relationship Manager

CAREER AHEAD 1.00 to 4.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

Key Responsibilities: field salesgold valuationgold loan operationsgold loanbfsi salesrelationship managerrelationship officersales manager

Accountant
PLACEMENT EXPERT Hiring For Congo DRC 4.00 to 9.00 Years Gurugram,Delhi, Bangalore, Chennai, Hyderabad, Vijayawada, Pune, Mumbai City 01 Apr, 2025

We have a requirement for Accountant with our client which Internet service provider in Kinshasa, Democratic Republic of the Congo. Position: Accountant englishaccounting

Mechanical Engineer Fresher
Sanskar HR Consultancy Services Hiring For Manufacturing Industry 0.00 to 1.00 Years Gurugram,Noida 01 Apr, 2025

Urgent Hiring for B.tech/Diploma Mechanical Engineer Job Description Total Vacancies: - 60 Dear Candidates Your Resume Is Shortlisted for Automobile & Manufa...
qualitydiplomamechanicalproductionmaintenance

Freelance Recruiter and Intern
KKD Consulting Hiring For KKD 0.00 to 1.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida, Sonipat, Palwal, Mumbai City, Meerut 01 Apr, 2025

Job Title: Freelance Recruiter & Recruitment Intern Location: Remote Job Type: Freelance / Internship
About Us:
[Y...
callingscreening

Sr HRBP Associate -Gurugram
MEGMA SERVICES 3.00 to 6.00 Years Gurugram 01 Apr, 2025

Leading engineering and construction company requires Sr HRBP Associate - Gurugram One of our client luxury brand which is Indias leading manufacturer of premium doors, windows, wood house and t...
hr operationshrbpassociate

Hiring for Field Sales Executive in Delhi NCR
AASAANJOBS PRIVATE LIMITED 1.00 to 5.00 Years Gurugram,Delhi 01 Apr, 2025

Meta Job Description Job Title: Sales Consultant Location: Delhi NCR Salary: 25000 CTC (Including Petrol allowance of 2000) Experience: 0-1 year Qualification : Graduate ...
salesfield salessales executive activities

Lead Generation Expert
Team Vertex India Global Services Private Limited Hiring For Lead Generation Expert 1.00 to 5.00 Years Gurugram,Delhi 01 Apr, 2025

Job Title: Lead Generation Expert Location: Gurgaon Job Summary: We are looking for a proactive and results-driven Lead Generation Expert to ...
voice processinternational call centertelecom salesinternational salesinternational bpoverizonatnt

E-commerce Account Managment Lead - CBT (Cross Border Trade)
ACUITTY CONSULTANTS LLP Hiring For AcuittyTech 1.00 to 2.00 Years Gurugram 01 Apr, 2025

Key Responsibilities: As an e-commerce account manager, you will work with one of the worlds largest companies to guide their partners ( business-to-businesskey account managementaccountabilitycommunication skillsexport import documentationrelationship buildingms excele-commerce account managementproduct listing

Data Modeler Team Lead/Architect
Angel and Genie 7.00 to 10.00 Years Gurugram 01 Apr, 2025

Data Modeler Architect Position: Data Modeler Architect Experience: 8 years Location: Gurugram Department: IT/Data Architecture Reports to: Data Architecture Lead / Data Manager Position Overvie...
big dataawsdata visualizationgcpazure

Marketing Executive
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Bhagalpur, Hyderabad, Pune, Patna, Guwahati 01 Apr, 2025

Marketing executives coordinate and oversee campaigns geared at promoting products, services, and causes. Marketing executives are adept at a variety of platforms, including print and social med...
marketing researchmarketing communicationmarketing managementbrand managementmarketing

Cnc Machinist
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Faridabad, Ambala, Hyderabad, Dhubri, Chandigarh, Bhillai, Silvassa, Guwahati 01 Apr, 2025

Job brief We are looking for a competentCNC Operatorto use computer numerically controlled (CNC) machinery safely and accurately to perform a variety of functions. Your job i...
cnc maintenanceconstructionengineeringconstruction engineeringconstruction equipmentcnc programmingcnccnc manufacturing

Hiring For Online Marketing Executive (Work From Home Or Office Both) DELHI-NCR
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 01 Apr, 2025

Dear Candidate Greetings fromDesnor Destination Pvt Ltd ! Job Summary Idealises Internet Marketing Agency is looking for Marketing Executive to join our dynamic team and embark on a rewarding...
marketing planningdigitaldisplay advertisingmarketingfreelancingwork from homemarketing communicationpart time

Phone Banking Officer
EBIXCASH GLOBAL SERVICES PRIVATE LIMITED 0.00 to 1.00 Years Noida 01 Apr, 2025

Payroll Company Name : - Ebixcash Global Services. www.ebixcashglobalservices.com Were hiring Male / Female Fresher and experienced candidates for Ebixcash Process ( Customer ...
tamil speakingtelugukannadatele sales excecutive

Accounting Specialist
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 3.00 to 7.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 01 Apr, 2025

Check figures, postings, and documents for accuracy. Organize, secure, and maintain all files, records, cash and cash equivalents in accordance with policies and procedures. Record, store, access...
qualitystandardsbillingaccountingfinance executivementorsupervisorpayrollfinancial

Full Stack Developer
LTIMindtree Limited 6.00 to 10.00 Years Noida,Hyderabad 01 Apr, 2025

Job Description Develop maintain enhance and test client systems of moderate to high complexity Execute full software development life cycle SDLC build highquality innovative and performing sof...
sdlcjavaaws

Quality Assurance Engineer
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 3.00 to 8.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

The QA technician role plays an important part in our companys product development process. Our ideal candidate will be responsible for conducting tests before product launches to ensure softwar...
automation testingmanual testingprocessqa analystquality analysttest engineerqualitytestingtest managerqa manager

German Language Specialist
Wroots Global Private Limited 1.00 to 6.00 Years Gurugram,Jaipur 01 Apr, 2025

Job Title: German Language Specialist International Voice Support Location: Jaipur & Gurgaon voice supportinternational voicecall centre voiceinternational bpogerman translationvoice processcustomer care

Labourer
ASSETCARE SERVICES PRIVATE LIMITED 1.00 to 5.00 Years Gurugram,Faridabad, Ghaziabad, Noida, Bangalore, Ongole, Chennai, Hyderabad, Kolkata, Patna 01 Apr, 2025

General laborers perform manual duties set out by supervisors. General laborers responsibilities include working with power tools, maintaining a clean work environment and receiving goods. ALabor...
communicationtechnologyliteracybasicinstructionsnumeracyfollowskillsstamina

Account Management Director
SPENTO PAPERS (INDIA) LLP 12.00 to 22.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Tadepalligudem, Mumbai City 01 Apr, 2025

We are seeking an experienced Account Management Director to lead and optimize our Account Management team. This leadership role will focus on driving customer success and revenue growth, ensuri...
medicaresalesservicemedicaidcustomerbusinessdevelopmentoversightprocessimprovement

Chief Talent Officer
SPENTO PAPERS (INDIA) LLP 25.00 to 0.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Itanagar 01 Apr, 2025

We are looking for a Chief Talent Officer who will support our talent acquisition and development activities. You will implement regular performance evaluations and be in charge of our employees...
engagementeeosystemhrispayrolldevelopmentorganizationplanningemployeesuccessionexcellentworkforceinterpersonalstrategic

Business Development Manager
ADITYA BIRLA SUN LIFE INSURANCE COMPANY LIMITED 1.00 to 2.00 Years Gurugram,Delhi, Faridabad, Ghaziabad 01 Apr, 2025

Designation:Agency Manager Education:Any Graduates Experience:Fresher with Good network / Min. 1 Yearin anyDomain Sal...
salesinsuranceagency channelbfsi sales

Plant Engineer
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 12.00 to 22.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Nellore, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

We are looking for a Plant Manager to drive continuous improvement and optimization of all processes.
Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla...
project engineeringprocess equipmentengineering processengineeringplant engineering

NTT DATA Virtual Drive Hedge Fund Gurgaon
NTT DATA INFORMATION PROCESSING SERVICES PRIVATE LIMITED 1.00 to 3.00 Years Gurugram 01 Apr, 2025

NTT DATA is Hiring experienced candidates for Hedge Fund Accounting domain. Location:Gurgaon Sector 48 (Candor Techspace) Work from Office Only Shift ...
reconciliationhedge fundsnav calculationinvestment banking

Hospital Manager
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 13.00 to 18.00 Years Gurugram,Delhi, Bangalore, Kochi, Chennai, Hyderabad, Kolkata, Kollam, Thiruvanananthapuram, Mumbai 01 Apr, 2025

We are looking for an experienced Hospital Administration Manager to run our medical facility. To be successful in this role, you should have a deep understanding of all administrative hospital ...
problemmanagementbudgetingassurancecollaborationcommunicationqualityfinancialsolving

Hospital Manager
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 13.00 to 18.00 Years Kochi,Kollam, Thiruvanananthapuram, Bangalore, Chennai, Hyderabad, Gurugram, Kolkata, Mumbai City, D 01 Apr, 2025

We are looking for an experienced Hospital Administration Manager to run our medical facility. To be successful in this role, you should have a deep understanding of all administrative hospital ...
problemmanagementbudgetingassurancecollaborationcommunicationqualityfinancialsolving

Procurement Assistant
SHARMA ENTERPRISES 1.00 to 6.00 Years Ernakulam,Kochi, Kozhikode, Malappuram, Thrissur, Gwalior, Indore, Bokaro, Ranchi, Bhopal 01 Apr, 2025

We are currently searching for a Procurement Assistant supports the purchasing and supply chain processes, assisting with tasks like sourcing suppliers, preparing purchase orders, maintaining pro...
purchase operationssupplier quality assurancesourcing materialsinventory managementrecord maintenancedata analysisrecord keeping

Team Coordinator
SHARMA ENTERPRISES 4.00 to 9.00 Years Ernakulam,Idukki, Kannur, Kasargod, Kochi, Kollam, Kottayam, Kozhikode, Thrissur, Wayanad 01 Apr, 2025

We are looking for a result-driven team leader to be responsible for monitoring and supervising a team of consultants to achieve the organizations objectives and increase sales. You will be respo...
navigationanalysisconflict preventioncommunication skillsproblem solvingleadership managementmanagement reportingcontrolreportingtask completionorganizational administration

Product Manager
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 15.00 to 25.00 Years Ernakulam,Wayanad, Pala, Thiruvananthapuram, Gwalior, Indore, Jabalpur, Bhopal, Ratlam, Sagar 01 Apr, 2025

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c...
product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing

PREV
NEXT

financial process improve Job Openings

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c... product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing

Production Engineer Job Description Template We are searching for a reliable, innovative production engineer to oversee manufacturing processe... labordiagnosisreportingdocumentationcommunicationsafetyscheduling managementmanufacturing processes

Pipeline Engineer Job Description Template We are looking for a highly experienced pipeline engineer to design and develop a variety of pipeline... budgetingblueprintcommunicationrepairconstruction technologytechnical standards

Key Responsibilities: field salesgold valuationgold loan operationsgold loanbfsi salesrelationship managerrelationship officersales manager

About Us:

Job brief We are looking for a competentCNC Operatorto use computer numerically controlled (CNC) machinery safely and accurately to perform a variety of functions. Your job i... cnc maintenanceconstructionengineeringconstruction engineeringconstruction equipmentcnc programmingcnccnc manufacturing

Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla... project engineeringprocess equipmentengineering processengineeringplant engineering

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c... product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c...
product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing

Production Engineer Job Description Template We are searching for a reliable, innovative production engineer to oversee manufacturing processe...
labordiagnosisreportingdocumentationcommunicationsafetyscheduling managementmanufacturing processes

Pipeline Engineer Job Description Template We are looking for a highly experienced pipeline engineer to design and develop a variety of pipeline...
budgetingblueprintcommunicationrepairconstruction technologytechnical standards

Job brief We are looking for a competentCNC Operatorto use computer numerically controlled (CNC) machinery safely and accurately to perform a variety of functions. Your job i...
cnc maintenanceconstructionengineeringconstruction engineeringconstruction equipmentcnc programmingcnccnc manufacturing

Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla...
project engineeringprocess equipmentengineering processengineeringplant engineering

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c...
product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing