Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Client Implementation and Operations Manager (Digital Care Coordination Solutions) Sep 03, 2019 Post Date 196358 Requisition # Justin Has...
Responsibilities Tasks Include:
Account Specialist Oct 08, 2019 Post Date 196357 Requisition # Justin Hastings - Chief Human Resources Officer, North America at Experian Justin Hastings talks about our culture of innovation and in...
eu sep ustomerservicemanagement customerservice clinicaloutcomes datareporting carecoordination servicemanagement talentacquisition msoffice monitoringprogress humanresources accountmanagement microsoftoffice financialresults relationshViscadia is the leading professional services firm focused exclusively on pharmaceutical and biotech forecasting. We are a rapidly growing firm , comprised of driven , collegial , and intellectually c...
primarymarketresearch timeseries marketresearch problemsolving microsoftoffice financialresults criticalthinking therapeuticareas secondaryresearch capabilitybuilding tatementsofw ksow healthcareinDepartment: 9400: Finance Finance/ Accounting Job Description About the Role As a member of the Corporate Controller s team, this position is responsible for assisting with the processing, accoun...
generallyacceptedaccountingprinciples timemanagement accountspayable customerservice financialresults invoiceprocessing enerallyacceptedaccountingprinciplesgaap vend master perf mancemetrics financialjuFinancial associate Responsibilities:
To plan, organize, develop, coordinate and administer the entire operations of the Hotel with a view to achieve the best financial results, guest comfort and safety, superior professional image for th...
food costing planning hospitality training hotel operations management maintenance supervision itchenmanagement customercomplaints financialresults menuc foodcosting menuplanning hotelmanagement hoteloperationAffluent in Tally ERP , must be able to handle Day to Day Book keeping Records including reconciliations of bank and credit card accounts , coordination and completion of annual audits , and reviewing...
msoffice tallyerp bookkeeping financialdata computerskills balanceaccounts financialresults budgetpreparation accountsreceivable accountingsoftware communicationskills financialjustification nternatioExperience 6-15 years including at least 3 years leading people Prefer Tier 1 capital markets experience. The candidate can come from a well-regarded global company in an industry where technology i...
java delivery agile apitalmarkets datamanagement customerrelations thoughtleadership bigdata datascience sqlserver functional frontoffice riskmanagement financialresults proprietarytr machinelearningExperience 5 10 years including at least 3 years leading people The candidate must have experience with a well regarded global company. Prefer Tier 1 capital markets experience. Alternatively, can ...
sqlserver datamanagement capitalmarkets machinelearning predictiveanalytics businessintelligence transactionprocessing sql etl ssis ourcesystemanalysis graduatelevel datagovernance financialresults set6-15 years including at least 3 years leading people Candidate should have experience creating similar applications at a respected global company. Prefer experience in financial services for familiar...
sql atacollection agileprocess datamanagement backoffice capitalmarkets financialresults financialservices datamining Job Profile: OPC Business Controller
In December 2017, ABB and SNC-Lavalin signed an agreement to form Linxon, a joint-venture company for the execution of engineering, procurement and co...
JD: ACCOUNTS MANAGER To ensure strict financial discipline in the Unit and to facilitate the achievement of the desired financial results through continuous review, analysis and sharing of performanc...
accounting accounts sales tds ervicetax benefitsanalysis costefficiency financialresults commerciallaws revenueenhancement budgetarycontrol internalaudit costmanagement balancesheetThe Lead Analyst , FP&A , Canada should have knowledge and hands on experience to play the following role: Monitoring , analyze and report out business performance and financial results Contribute...
delivery reporting java mentoring sql atacollection msoffice sassql retailtechnology businessservices financialresults supplychain rootcauseLocation : Tumkur, Near Bangalore ( 60kms away from Bangalore) Qualification : CS ( membership of ICSI is a must i.e. ACS / FCS) Employee Size : 110 employees Responsibilities : Organise and prep...
tax ositivepay contractualagreements financialjustification legislativerelations annualreturns publicrelations financialreporting companysecretary financialmanagement generalledger financialresults pay5 - 12 Lakhs Per Annum To Apply This Job AddThis Sharing Buttons Job Description Employer : Canadian Aerospace Joint Venture- Pvt Ltd Company Designation : Company Secretary Location : Tumkur...
taxreturns cashmanagement companysecretary financialsystems payrollmanagement atetax generalledger costeffective grouprep ting financialresults statut yrep ting capitalexpenditure financialac
Job Description
Job Title: Chief Manager - Financial Analyst
Reports to: Head of Finance - South Asia
Division: Lubrizol Advanced Materials Indi...
finance basis accounts customerrelations continuousimprovementfacilitation southasia keymetrics keysystems costreduction annualplanning indirecttaxation financialresults ep ting ateliaison financiThis position is accountable for the financial, and risk management operations of the company, to include the development of a financial and operational strategy, metrics tied to that strategy, and th...
tax risk uditcommittee riskmanagement financialjustification duediligence strategicbusiness transactionprocessing operationalstrategy recordkeeping financialresults investorrelations
Client Implementation and Operations Manager (Digital Care Coordination Solutions) Sep 03, 2019 Post Date 196358 Requisition # Justin Has...
Should have a minimum of 8 years of experience in this field. ( Minimum 3 years at Center Manager Level ). Any Graduate / Post Graduate/ MHM Qualified. Prior Experience into Hospital / Diagnostics ...
marketing sales management businessdevelopment mis frontoffice customerservice staffscheduling employeetraining financialresults qualitymanagement hr his foot prime camps retail drives tatut ycompliance meViscadia is the leading professional services firm focused exclusively on pharmaceutical and biotech forecasting. We are a rapidly growing firm , comprised of driven , collegial , and intellectually c...
primarymarketresearch timeseries marketresearch problemsolving microsoftoffice financialresults criticalthinking therapeuticareas secondaryresearch capabilitybuilding tatementsofw ksow healthcareinTo plan, organize, develop, coordinate and administer the entire operations of the Hotel with a view to achieve the best financial results, guest comfort and safety, superior professional image for th...
food costing planning hospitality training hotel operations management maintenance supervision itchenmanagement customercomplaints financialresults menuc foodcosting menuplanning hotelmanagement hoteloperationDear Candidates, Urgently require Male candidates for the profile of Chief Financial Officer. Job Location : North Delhi. Shift Timings : 9 Am to 6 Pm Sunday Fixed off. Plz find the JD below. Th...
tax cash forms basic ralcommunication continuousimprovementfacilitation bankingrelationships operationalstrategy strategicbusiness transactionprocessing duediligence riskmanagement companylaw financialresults financialjustification corporatDear Candidates, Urgently require Male candidates for the profile of Chief Financial Officer. Job Location : North Delhi. Shift Timings : 9 Am to 6 Pm Sunday Fixed off. Plz find the JD below. Th...
tax cash forms basic ralcommunication continuousimprovementfacilitation bankingrelationships operationalstrategy strategicbusiness transactionprocessing duediligence riskmanagement companylaw financialresults financialjustification corporatDear Candidates, Urgently require Male candidates for the profile of Chief Financial Officer. Job Location : North Delhi. Shift Timings : 9 Am to 6 Pm Sunday Fixed off. Plz find the JD below. Th...
tax cash forms basic ralcommunication continuousimprovementfacilitation bankingrelationships operationalstrategy strategicbusiness transactionprocessing duediligence riskmanagement companylaw financialresults financialjustification corporat
The Balance Sheet Analytics Team is a new dedicated function within the Finance organization under the Global Head of Financial Planning Analysis (FPA).
The team will d...
sales mis accounts tat banking strongcommunicationskills balancesheet highpressure driveresults microsoftoffice financialresults financialservices financialplanning financialproducts atestrategy buAffluent in Tally ERP , must be able to handle Day to Day Book keeping Records including reconciliations of bank and credit card accounts , coordination and completion of annual audits , and reviewing...
msoffice tallyerp bookkeeping financialdata computerskills balanceaccounts financialresults budgetpreparation accountsreceivable accountingsoftware communicationskills financialjustification nternatioFinancial support to business areas through financial analysis, budgeting, planning & forecasting; to facilitate decision making and future business strategies. As a member of Oracles finance organiza...
finance basis accounts customerrelations expenseanalysis varianceanalysis financialresults financialanalysis accountsreceivable financialaccounting compatibilitytesting ep ting alcommunicationThe Senior Analyst , Store Ops / Div Support should have knowledge and hands on experience to play the following role: Monitoring , analyze and report out business performance , financial results an...
reportingaccountsbasisresearchustomerrelationsdatacollectionsupplychainmsofficebusinessservicesfinancialresultsSupport the business control function, support budget preparation and budget control, prepare and provide timely and accurate MIS to management to support financial stability. Provide inputs for repo...
financemanagementexternalauditbudgetpreparationcwacontrolbusinessreptingpreparationreconciliationbudgetcontrolbusinesscontrolfinancialresultsDear Candidates, Urgently require Male candidates for the profile of Chief Financial Officer. Job Location : North Delhi. Shift Timings : 9 Am to 6 Pm Sunday Fixed off. Plz find the JD below. Th...
accountsaccountingfinanceperationalstrategytransactionprocessingcorporatefinanceoralcommunicationworkingcapitalfinancialoperationscontinuousimprovementfacilitationstrategicbusinessbankingrelationshipsfinancialresultsriskmanagementDear Candidates, Urgently require Male candidates for the profile of Chief Financial Officer. Job Location : North Delhi. Shift Timings : 9 Am to 6 Pm Sunday Fixed off. Plz find the JD below. Th...
accountsaccountingfinanceperationalstrategytransactionprocessingcorporatefinanceoralcommunicationworkingcapitalfinancialoperationscontinuousimprovementfacilitationstrategicbusinessbankingrelationshipsfinancialresultsriskmanagementThe Financial Analyst should have knowledge and hands on experience to play the following role: Monitor and analyze and report out business performance , financial results and other KPIs which defin...
sqlatacollectionmsofficefinancialanalysisbusinessservicescommunicationskillsfinancialresultsThe Lead Analyst , FP&A , should have knowledge and hands on experience to play the following role: Monitoring , analyze and report out business performance and financial results Contribute to Ide...
deliveryreportingjavamentoringsqlatacollectionmsofficeretailtechnologyfinancialresultssupplychainrootcause
Basic Purpose of Job: The Expense Insight Center/ Expense COE Manager provides subject matter knowledge in the assigned area of Financial Planning Analysis, develops a thorough understanding of Stat...
dataanalyticslinemanagementmicrosoftofficevarianceanalysisfinancialservicestatementsofwksowstrongcommunicationskillsnewbusinessmusicmakinghighpressuredriveresultsfinancialresultsfinRoles and responsibilities The Expense Insight Center/ Expense COE Analyst provides subject matter knowledge in the assigned area of Financial Planning Analysis, develops a thorough understan...
dataanalyticslinemanagementmicrosoftofficevarianceanalysisfinancialservicestatementsofwksowstrongcommunicationskillsnewbusinessmusicmakinghighpressuredriveresultsfinancialresultsfinCompletion of high quality deliverables within the committed timeframe. Deliverables vary by BU focus but typically relate to; Month / quarter / year- end closing and forecast Annual operational p...
strongcommunicationskillsnewbusinesshighpressuredriveresultsdataanalyticslinemanagementmicrosoftofficehyperionessbasevarianceanalysisfinancialresultsfinancialservicestatementsofwksowExperience 5 10 years including at least 3 years leading people The candidate must have experience with a well regarded global company. Prefer Tier 1 capital markets experience. Alternatively, can ...
sqlserverdatamanagementcapitalmarketsmachinelearningpredictiveanalyticsbusinessintelligencetransactionprocessingsqletlssisourcesystemanalysisgraduateleveldatagovernancefinancialresultssetExperience 6 15 years including at least 3 years leading people Prefer Tier 1 capital markets experience. The candidate can come from a well regarded global company in an industry where technology i...
javaagiledeliveryunctionalriskmanagementmachinelearningdatasciencethoughtleadershipfinancialresultsbigdatacustomerrelationsdatamanagementfrontofficecapitalmarketssqlserverriskanalytics6-15 years including at least 3 years leading people Candidate should have experience creating similar applications at a respected global company. Prefer experience in financial services for familiar...
sqlatacollectionagileprocessdatamanagementbackofficecapitalmarketsfinancialresultsfinancialservicesdataminingTo plan, organize, develop, coordinate and administer the entire operations of the Hotel with a view to achieve the best financial results, guest comfort and safety, superior professional image for th...
foodcostingplanninghospitalitytraininghoteloperationsmanagementmaintenancesupervisionitchenmanagementcustomercomplaintsfinancialresultsmenucfoodcostingmenuplanninghotelmanagementhoteloperationFinalisation of standalone and consolidated financial statements under IGAAP Compliance with Accounting standards, Companies Act and internal control over financial reporting (ICFR) GL scrutiny, P&...
bankingmarketingsalesfinanceaccountscompaniesactstockexchangetatementsofwksowconsolidatedfinancialstatementsplanalysisinternalcontrolfinancialresultsexpenseallocationknowledgetransferEssential Duties and Responsibilities Develop Complex Financial Models and Present Analytics to Support Sales Team Assist in Developing Complex Models that Support the Financial Modeling Related to Po...
financebasisaccountsdeferredrevenuescenarioanalysisfinancialanalysisfinancialplanningtingcustomerrelationsusersuppannualbudgetsatefinancefinancialresultscommercialmodelsrepLocation : Tumkur, Near Bangalore ( 60kms away from Bangalore) Qualification : CS ( membership of ICSI is a must i.e. ACS / FCS) Employee Size : 110 employees Responsibilities : Organise and prep...
taxositivepaycontractualagreementsfinancialjustificationlegislativerelationsannualreturnspublicrelationsfinancialreportingcompanysecretaryfinancialmanagementgeneralledgerfinancialresultspay5 - 12 Lakhs Per Annum To Apply This Job AddThis Sharing Buttons Job Description Employer : Canadian Aerospace Joint Venture- Pvt Ltd Company Designation : Company Secretary Location : Tumkur...
taxreturnscashmanagementcompanysecretaryfinancialsystemspayrollmanagementatetaxgeneralledgercosteffectivegroupreptingfinancialresultsstatutyreptingcapitalexpenditurefinancialac
ZS professionals draw on deep industry and domain expertise to deliver impact where it matters for clients. We are particularly known for our expertise in the pharmaceutical and health care sectors , ...
msaccessvisualbasicproblemsolvingbusinessacumenbusinessanalysismanagementskillsdemandgenerationfinancialresultscommercialmodelsthoughtleadershipbusinessoperationstatementsofwksowservMust be able to work in a fast paced environment Must possess strong communication skills with ability to participate in or lead conference calls and present financial results to financial and non- f...
dataanalyticsmicrosoftofficehyperionessbasevarianceanalysisfinancialservicestatementsofwksowstrongcommunicationskillsnewbusinesshighpressuredriveresultsfinancialresultsbusinessknowledgeRoles and responsibilities The Expense Insight Center/ Expense COE Analyst provides subject matter knowledge in the assigned area of Financial Planning Analysis, develops a thorough understan...
dataanalyticslinemanagementmicrosoftofficevarianceanalysisfinancialservicestatementsofwksowstrongcommunicationskillsnewbusinessmusicmakinghighpressuredriveresultsfinancialresultsfin© 2019 Hireejobs All Rights Reserved