handle unexpected situations jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

handle unexpected situations Job Openings

Showing 18451 - 18500 of 19449 Jobs

Centre Director For Corporate Pre School at Sector 22 and Sector 59 Gurugram

HR Globe Recruitment Service 3.00 to 8.00 Years Gurugram 16 Oct, 2023

early childhood education

early childhood development

years

Customer Care Representative

Tech Mahindra Ltd 0.00 to 4.00 Years Delhi 16 Oct, 2023

| Mega Walk-in drive at Tech Mahindra for Premium Voice Process- (Work from office) Noida location.|

Job Role

Field Sales Representative

Job Search Hiring For Lubricant Manufacturing Company 3.00 to 5.00 Years Mohali 16 Oct, 2023

Job Role:

presentation skills

identifying sales opportunities

business development

product knowledge

lubricant sales

evaluate customers needs

Process Analyst Finance and Administration Delivery

IBM India Pvt Limited 2.00 to 4.00 Years Chennai 16 Oct, 2023

Procure to Pay Operations New Associate-Procure to Pay Processing

Accenture 0.00 to 1.00 Years Chennai 16 Oct, 2023

Skill required: Procure to Pay Processing - Invoice Processing Operations

Designation: Procure to Pay Operations New Associate

...
accounts payableaccounts payablereceivableapproval processbudgetingcreditcredit notebusiness processemail managementinvoice processingclient relationshipprofessional servicesfinancial justificationerppaycloudemailclaimsvendor

Area Sales Manager
NTECH IT SOLUTIONS PRIVATE LIMITED 3.00 to 8.00 Years Bangalore 16 Oct, 2023

Job Responsibilities::

Identify the person from ADM team to execute and help us with sales execution.

Discuss enquiry with Sr. Sales Executive

I...
revenue generationteam handlingteam management

Customer Support Associate
The Job Factory Fresher Bangalore 16 Oct, 2023

Openings for Bpo Jobs Customer Support Associate Job Responsibilities :

Answer inbound customer calls.

kannadatamil

Branch Manager
SARVP FINANCIAL SERVICES 4.00 to 6.00 Years Vadodara 12 Oct, 2023

Job description

Training employees and evaluate their performances.

Create strategies to ensure that sales targets are met....
recruitmentteam managementbranch managementtrainingsales planning

Key Account Manager
First Solution 4.00 to 5.00 Years Vadodara 12 Oct, 2023

Designation:Key Agency Manager Office of Excellence CTC:5 to 6. lacs (Fixed) Other Variables Grade M7 Location Baroda Role/Responsibilities:

To support sales team for closing high...
insuranceaccount managementsales support

Acadamic Consultant
Pleasant Inc 0.00 to 4.00 Years Surat 12 Oct, 2023

To be successful in this role, you ll need to have the following skills: Integrity: As an AC, we entrust you with our Customer Resource Management (CRM) tool and sensitive student-related data. We...
resource managementEmployee Referral ProgramsProgramme Delivery

HO Acquisition Manager- Digital Sales
GRAMPRO BUSINESS SERVICES PRIVATE LIMITED 0.00 to 2.00 Years Rourkela 12 Oct, 2023

HO Acquisition Manager- Digital Sales

Job Role-

Have good awareness of Corporates with entr...
salesmanagementit salescross sellingmarketingdigital marketing

Urgent requirement welder/scaffoldingRatnagiri Maharashtra India (Onshore )
APEX OFFSHORE SERVICE 0.00 to 4.00 Years Pondicherry 12 Oct, 2023

Greetings we are hiring for the position of WELDER | SCAFFOLDING | WELDING | PIPE FITTER | with a leading Oil & Gas Industry Company. ( Onshore Job ...
tig welderweldingsmig welderweldrfitteriti welderiti fitterpipe fitter6 g welder

WANTED SALES AND RELATIONSHIP MANAGER FOR LIFE INSURANCE
CHENNAI JOBS Hiring For Life Insurabce Companies 1.00 to 6.00 Years Pondicherry 12 Oct, 2023

Dear Candidate, Urgently require candidates for BANCA, DIRECT and AGENCY Vertical for LIFE INSURANCE COMPANY Location : CHENNAI, COIMBATORE, MADURAI, T...
insurance salesdirect marketinginsurancesalesbranch salesmarketingdirect sales

Analyst - Business Consulting
Infosys Limited 0.00 to 1.00 Years Pune 12 Oct, 2023

We are looking for smart, self-driven, high-energy people with top-notch communication skills, intellectual curiosity and passion for excellence. Our analysts have a blend of in-depth domain exper...
root cause analysissubject matter expertisebusiness process improvementcomputerized system validation21 cfrroot causeit projectsdata privacygap analysisdata integritylarge projectsrisk managementmedical devicesglobal deliverythinking skills

ADAS Senior_Developer_(C)_2023_MS/EDX7-XC
Bosch Group 0.00 to 4.00 Years Pune 12 Oct, 2023

Job Description Design & Implementation of in-house SIL (software in the loop) simulation tool for next generation Advanced Driver Assistance Systems for Situation Analysis area. Setting up and ...
situation analysissilscrumrunninganalysissimulationparticipationimplementationDifficult SituationsSituational AwarenessIntelligent AgentsCrisis SituationsCustomer RequirementsOrganizational CommitmentData Driven TestingStressful Situations

Customer Care Representative
Tech Mahindra Ltd 0.00 to 4.00 Years Noida 12 Oct, 2023

| Mega Walk-in drive at Tech Mahindra for Premium Voice Process- (Work from office) Noida location.| Job Role: Senior Customer care executive (6 Days working). ...
insurance salestelecom salesvoice processcustomer servicecustomer supportcustomer caretelecalling

Solution Architecture Manager Solution Ination
Accenture 13.00 to 18.00 Years Noida 12 Oct, 2023

Skill required: Solution Architecture - Solution Architecture Designation: Management Level - Manager Job Location: Noi...
javadeliverycustomer relationssalesenvironmentstrong analytical skillsproblem solvingsenior managementanalytical skillsfinancial reportingclient requirementssolution architectureprofessional servicesfinancial justificationsetrfpscloudstra

Accountant Manager,Assistant Accountant,Account Assistant
AppSoft Solutions 0.00 to 4.00 Years Noida 12 Oct, 2023

Job Description
Description:

To handle cash.

Dealing with the bankers.

Generation of MIS Reports.

En...
accountingtallyaccountssales

Financial consultant - B2B
Umind Consulting 0.00 to 2.00 Years Noida 12 Oct, 2023

Financial Consultant - B2B Responsible for offering comprehensive financial advisory and investment services to our clients. Your primary focus will be on helping clients achieve their financial...
customer serviceportfolio management

Customer service (Telesales) VIP Sales - Telecalling Outbound sales
SYGNIFIC SERVICES 1.00 to 5.00 Years Other Maharashtra 12 Oct, 2023

Customer service (Telesales) VIP Sales - India - telecalling Outbound sales Min 1 year telecalling hardcore sales experience and Min 1 year Customer Service or Sales experience HSC Good commun...
salescustomer servicetelesales

Customer Care Representative,
VARDAN NURSING HOME PRIVATE LIMITED 2.00 to 6.00 Years Mumbai City 12 Oct, 2023

Job Title - Customer Care Representative, Business Development Executive, Patient Care Coordinator Address: Allure Medspa,201, Shri Krishna Complex, 2nd Floor,Close to Fun Republic Cinema, New ...
customer retentionconvincing powersalescommunication skills

Social Impact Executive
TEAM STREET CONSULTANCY PRIVATE LIMITED 0.00 to 4.00 Years Mumbai City 12 Oct, 2023

About Medecins Sans Frontires: Medecins Sans Frontires, also known as Doctors Without Borders, is a non-profit international humanitarian organization that provides medical aid t...
salesfield marketingfield work

Product Executive
Zecruiters Jobconnect Private Limited Hiring For IT hardware 1.00 to 4.00 Years Mumbai City 12 Oct, 2023

Job Brief:

Product management with P&L

Stocking, Forecast and negotiations

Helping team for commercials and other aspects

Handle few majo...
process managementproduct managementit hardwareoemproduct

Software Programmer
Sunil Kumar Hiring For Sunil 1.00 to 6.00 Years Mumbai City 12 Oct, 2023

I want to return status code204 No Contentfrom a Django view. It is in response to an automatic POST which updates a database and I just need to indicate the update was successful (w...
tornadodjangotwistedmakopylonspython

Audit Manager
MULTI RECRUITERS 5.00 to 10.00 Years Kochi 12 Oct, 2023

Audit manager will be responsible for planning, assigning, and supervising the daily tasks given to other auditors in the organization. Audit Manager will help to train ...
audit managementstatutory auditexternal reportingaudit reportstax auditsinternal auditaudit professionalsaudit compliance

Internal Auditor
MULTI RECRUITERS 0.00 to 2.00 Years Kochi 12 Oct, 2023

Internal Auditor will be responsible for planning, assigning, and supervising the daily tasks given to other auditors in the organization. Audit Manager will help to tra...
audit managementstatutory auditexternal reportingaudit reportstax auditsinternal auditaudit professionalsaudit compliance

Next.JS Developer
People First Consultants Pvt Ltd 3.00 to 8.00 Years Kochi 12 Oct, 2023

Greetings ! This is Nivetha Shankar from People First Consultants. We have great pleasure in sending this email from People First Consultants, a firm that specializes in Top Management placemen...
react.jsdevelopers

Assistant Officer
Krishna Consultancy Hiring For Reliance Industries Ltd 8.00 to 13.00 Years Kanpur 12 Oct, 2023

An assistant is responsible for the smooth and efficient running of an office through performing administrative and clerical duties, as well as providing reliable support for managers, staff, and...
emotional intelligenceorganizationtime managementtechnologycommunication skillsproblem solving

Production Supervisor, Production Manager, Production Executive
ARYAN TECHNOLOGY 0.00 to 4.00 Years Hyderabad 12 Oct, 2023

Production Manager Job Responsibilities:

Supports the senior producer and assists the team by focusing on schedules, velocity tracking, and dependency management
...
managementfilm productionprocess improvementmilestonesproposalsoddhigh level of organizationqualitysetsafetyproduction planninghandle multiple projectsquality controldependency managementinspectionvelocityfilmtelevisionproject management

Practitioner Finance and Administration Delivery
IBM India Pvt Limited 0.00 to 4.00 Years Hyderabad 12 Oct, 2023

Introduction The Finance & Admin Business Analyst is essential to the ongoing profitable operations for one of the most globally recognized and respected companies in the world. By overseeing our ...
time managementfixed assetsservice leveldesign thinking

Vendor Management New Associate-Procurement management
Accenture 0.00 to 1.00 Years Gurugram 12 Oct, 2023

Skill required: Procurement management - Vendor Management Designation: Vendor Management New Associate Job Location: G...
accounts payableaccounts payablereceivableapproval processbudgetingcreditroot causeissue resolutionvendor managementthought leadershipclient relationshipsupplier enablementcommunication skillsprofessional servicesperformance measurement

Sales Manager
Williams Consulting Pvt Ltd 2.00 to 4.00 Years Gurugram 12 Oct, 2023

Skills required:

Excellent written and spoken English with complete clarity in diction and

Motivated to learn, share and apply sales processes and<...
senior salesbusiness development

Team Leader
Tech Artist 1.00 to 3.00 Years Noida 12 Oct, 2023

Handle a team of people under you

Achieve sales target through the team

Individual as well as team targets

Minimum of 1 year experience of health insurance ...
inside salesb2b salesteam handlingteam leadingcold callingbusiness developmentcommunication skillshealth insurancesales

Hiring for Authorizer for Leading Bank at Delhi-Mukherjee Nagar & Mansarovar
V-Konnect Associates Hiring For Hiring for Authorizer for Leading Bank at Delhi-Mukherjee Nagar & Mansarovar 3.00 to 8.00 Years Delhi 12 Oct, 2023

Jole Role- Cash Management & Operations: Responsible for efficiently managing the cash operations (receipt & payment) across the counter including ATM replenis...
customer servicepersonal bankingcash handlingbranch operationsbanking operationsteller operations

Sales Officer
Skywings Advisors Private Limited 0.00 to 4.00 Years Gurugram 12 Oct, 2023

Job Description
ROLES & RESPONSIBILITIES:

Quality acquisition of Home loans by going out into the market & catchment area.

Cross sell banking product l...
field salessaleshousing loanbankingloanslapcross sellingbanking sales

Operation Associate
SAFE LEDGER PRIVATE LIMITED Fresher Gurugram 12 Oct, 2023

About the Company: Registerkaro is a leading provider of finance accounting and taxation services, dedicated to assisting businesses in their formation and compliance needs. We o...
operationsfinancial reporting

Pd Merchandiser,
Cg Education & Placement Consultants 2.00 to 5.00 Years Noida 12 Oct, 2023

Dear Candidates, Greetings from Cg Placement !!!! URGENT OPENING FOR PD Merchandiser Company: Home Furnishing Export House Qualification: Textile Di...
product developmenthome textiles

Accountant
RISEOM TOOL CRAFTS PRIVATE LIMITED 3.00 to 8.00 Years Delhi 12 Oct, 2023

We are seeking trustworthy candidates who work efficiently without sacrificing accuracy. Accountants can expect to work with large amounts of numerical data, handle multiple tasks with deadlines,...
industrycommunicationgoodadaptabilitycollaborationknowledgesummaryskillsefficiencytime-saving

Production Supervisor, Production Manager, Production Executive
ARYAN TECHNOLOGY 0.00 to 4.00 Years Gurugram 12 Oct, 2023

Production Manager Job Responsibilities:

Supports the senior producer and assists the team by focusing on schedules, velocity tracking, and dependency management
...
managementfilm productionprocess improvementmilestonesproposalsoddhigh level of organizationqualitysetsafetyproduction planninghandle multiple projectsquality controldependency managementinspectionvelocityfilmtelevisionproject management

Marketing & Sales Executive
S P Jagannath & Sons Hiring For Marketing & Sales Executive 2.00 to 5.00 Years Delhi 12 Oct, 2023

MARKETING & SALES EXECUTIVE SPJ Group has been a renowned group in the market since 1962, and we are looking forward to passionate candidates wh...
distribution channel salessales planningdirect salesretail salesmarketingdistribution

District Manager - Medical Representative (Dermatology)
Talent Corner HR Services Pvt Ltd 2.00 to 7.00 Years Delhi 12 Oct, 2023

Position Summary: You will be responsible for driving business growth in assigned territory, maintaining effective customer relations, mapping territory potential, cascading scie...
medical salesdermatologysalesrepresentativemedical

Call Centre / BPO / Executive
Best Placement Service Hiring For International and Domestic Call Center 0.00 to 2.00 Years Chandigarh 12 Oct, 2023

Hi we are hiring for customer care executive profile Have a good communication skills *Responsibility:-* * Both Female & Male Candidates can apply for the job * Salary between 15K to 45K p.m....
domestic bpointernational call centerkpobpo non voicevoice processprocess orientation

Customer Care Executive - Females
IMF Consultants 2.00 to 4.00 Years Chennai 12 Oct, 2023

Customer Care Executive - Females Location: Chennai Experience: 2 to 4 years Education: Diploma/ITI Industry: Automobile / Auto Ancillaries Roles and responsibilities for Customer support exe...
customer supportcustomer service skillscustomer care

BlueYonder Space & Floor Planning Business Architect
Accenture 8.00 to 10.00 Years Chennai 12 Oct, 2023

About Accenture: Accenture is a global professional services company with leading capabilities in digital, cloud and security. Combining unmatched experience and specialized skill...
analyticsbillingbusiness requirementsetllandscapingunix shell scriptingbusiness caseteam managementshell scriptingoracle databasebusiness solutionscategory managementcommunication skillsprofessional servicescustomer requirementstechnical ar

Sr Operations Manager, Amazon Transportation Services
Amazon 0.00 to 4.00 Years Bangalore 12 Oct, 2023

At Amazon, were working to be the most customer-centric company on earth. To get there, we need talented, bright and driven people. Amazon is one of the most recognizable brand names in the world ...
salesdeliverycustomer relationsmarketingmanagementbias for actionsix sigmasite operationsdaily operationspeople managementquality standardscost optimizationprocess improvementbehavioral trainingcustomer experiencecontinuous improvementopti

Home Lending Risk Strategic Analytics - Associate
JPMorgan 0.00 to 4.00 Years Bangalore 12 Oct, 2023

The HL Risk Strategic Analytics team spans the globe, primarily sitting in Plano, TX and Bengaluru, India, however we have staff and executive presences across 9 locations worldwide: Plano TX, C...
source system analysismusic makingloan servicingrisk managementcapital marketsdata manipulationstrategic analyticsrelational databasescompatibility testingfinancial justificationmissassqlriskstemtrustoraclecredit

IN EDC_Embedded Specialist_2023
Bosch Group 0.00 to 4.00 Years Bangalore 12 Oct, 2023

Job Description SX/EDC is a strong partner for DC (Bosch Rexroth Germany) in software development supporting different business units like DC-AE, DC-MH, DC-AT, DC-LT. DC-MH future product portfo...
high performance drivingembedded software developmentembedded cbusiness unitslanguage skillsembedded softwareproduct portfoliodevelopment toolsembedded engineersconcept developmentsoftware developmentarchitectural designsoftware engineering

Accountant Manager,Assistant Accountant,Account Assistant
AppSoft Solutions 0.00 to 4.00 Years Bangalore 12 Oct, 2023

Job Description
Description:

To handle cash.

Dealing with the bankers.

Generation of MIS Reports.

En...
accountingtallyaccountssales

Guest Relations Executive
MNR Solutions Pvt Ltd 2.00 to 7.00 Years Bangalore 12 Oct, 2023

Urgent hiring for Guest Relation Executive / Community Building Executive - Bangalore CTC- 3.60 LPA Experience - 2 years minimum Qua...
compliance managementguest relationsguest service

HIRING FOR MAXIMO- APPLICATION DEVELOPER
Inspiration Manpower Consultancy Private Ltd 5.00 to 8.00 Years Bangalore 12 Oct, 2023

Job description Job Key Responsibilities : -Having 6-8 years of experience in Maximo java customization -Technical/Functional expertise on more than one of Industry Specific...
application developmentapplication programming

PREV
NEXT

handle unexpected situations Job Openings

Job Description

Skills required:

ROLES & RESPONSIBILITIES:

Job Description

Job description Job Key Responsibilities : -Having 6-8 years of experience in Maximo java customization -Technical/Functional expertise on more than one of Industry Specific... application developmentapplication programming

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Job description Job Key Responsibilities : -Having 6-8 years of experience in Maximo java customization -Technical/Functional expertise on more than one of Industry Specific...
application developmentapplication programming