human resources development jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

human resources development Job Openings

Showing 45951 - 46000 of 72966 Jobs

Opening Retail Agency Sales at SBI Life Insurance - Tamil Nadu

SBI Life Insurance Company Limited 1.00 to 6.00 Years Chennai,Vellore, Madurai, Other Tamil Nadu, Salem, Tiruchirappalli, Kodaikanal, Namakkal, Coimbatore 29 Oct, 2024

Sales Professionals Wanted IA Channel Sales at SBI Life Insurance

SBI Life Insurance Company Limited 1.00 to 6.00 Years Chennai,Vellore, Tambaram, Thirunelveli, Tiruvannamalai, Madurai, Other Tamil Nadu, Tiruchirappalli, 29 Oct, 2024

Business Development Executive

Skywings Advisors Private Limited 1.00 to 6.00 Years Chennai,Karnal, Mangalore 29 Oct, 2024

Demand Generation Manager

SAIKOR SECURITY TRAINING AND SERVICES PRIVATE LIMITED 18.00 to 25.00 Years Chennai,Bangalore, Noida, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi, Port Blair 29 Oct, 2024

Business Development Manager

NEEDION SOLUTIONS PRIVATE LIMITED 1.00 to 4.00 Years Chennai,Nellore, Guntur, Bangalore, Rajahmundry, Kurnool, Hyderabad, Guntakal, Kakinada, Anantpur 29 Oct, 2024

Assistant Finance Manager

MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 3.00 to 7.00 Years Chennai,Bangalore, Noida, Hyderabad, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

Job description

Developing an understanding of the strategies that drive our growth, you will be at the forefront of how we evolve to meet our goals. We have Finance Business Part...
payrollsupply chainprocurementrisk managementcustomer developmentforecastingfinancial reportinganalytical

Quality Manager

LEADZN PRIVATE LIMITED 6.00 to 11.00 Years Chennai,Zimbabwe, Mozambique, Bangalore, Noida, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Gha 29 Oct, 2024

Buyer (Commodity)

DOMNIC LEWIS PRIVATE LIMITED 3.00 to 7.00 Years Chennai,Bangalore 29 Oct, 2024

Bio-tech Research Associate / Scientist

NEW ERA LIFE CARE PRIVATE LIMITED 2.00 to 7.00 Years Chennai,Iran, Zimbabwe, Mozambique, Jaipur, Bangalore, Iraq, Noida, Hyderabad, Kolkata, Lebanon, Gur 29 Oct, 2024

We are looking for a Biologist to join our team and conduct research and experiments to gain a better understanding about different biological organisms in nature.

Biol...
sciencebiochemical engineeringresearch analysisbioprocessingmicrobiologybiochemistryneurostimulationmicrobiological analysisbiologics

Test Automation Architect
UST Global 10.00 to 16.00 Years Chennai,Bangalore, Kochi, Noida, Hyderabad, Pune, Thiruvanananthapuram 29 Oct, 2024

Test Automation Architect Position Overview: We are seeking an experienced Test Automation Architect to design, develop, and maintain robust automation framewo...
pythonquality assurancejavaseleniumtosca

Quality Management Process Architect
UST Global 12.00 to 22.00 Years Chennai,Bangalore, Kochi, Noida, Hyderabad, Pune, Thiruvananthapuram 29 Oct, 2024

Quality Management Process Architect/Process Consultant Location: Kochi/Trivandrum/Hyderabad/Bangalore/Chennai/Pune/Noida Notice Period: Immediate-30 days
...
six sigmaqms

Java Developer
UST Global 5.00 to 10.00 Years Chennai,Bangalore, Kochi, Noida, Hyderabad, Pune, Thiruvanananthapuram 29 Oct, 2024

Role Proficiency: Independently develops error free code with high quality validation of applications guides other developers and assists Lead 1 Software Engineering D...
spring bootjavamicroservices

Support Engineer
NEW ERA LIFE CARE PRIVATE LIMITED 10.00 to 20.00 Years Chennai,Bangalore, Noida, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City, Delhi 29 Oct, 2024

Were expanding our Engineering Operations team and seeking a diligent Support Engineer to help us scale effectively. In this role, youll tackle production issues, address technical queries from c...
systemcivilsecurityprocurementsupportmaintenancebusinesslogisticsqualityanalystmanagerelectricalinspectorsupervisorwarehouseengineer

EBS Apps technical
LTIMindtree Limited 10.00 to 20.00 Years Chennai,Bangalore, Noida, Hyderabad, Pune, Mumbai City, Delhi 29 Oct, 2024

LTIMindtree is hiring for Apps technical job opportunity. Exp required: 5 to 12 yrs Location: All LTI Offices Below is the JD: Oracle Module Expertise Oracle Inventory Order Management and Cu...
apioracle inventoryoracle soa suiteebswebservicesoracle order managementoracle scmr12oracle ebs

Product Partner Manager
NEW ERA LIFE CARE PRIVATE LIMITED 14.00 to 24.00 Years Chennai,Bangalore, Noida, Kadapa, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

Were seeking a Product Partner Manager to join our dynamic team, focusing on expanding our network of HR technology partnerships. In this role, youll manage the entire partnership lifecycle, from...
business developmentproject managementstrategic partnershipsaccount managementdigital marketingcustomer servicepartner relationshipsclient facing

Senior Merchandiser
TRAAB ENGINEERING INDIA PRIVATE LIMITED 14.00 to 24.00 Years Chennai,Bhubaneswar, Bangalore, Cuttack, Idukki, Hyderabad, Pathanamthitta, Kolkata, Mumbai City, De 29 Oct, 2024

Senior Merchandisers make sure products appear in the right retail units at the appropriate time and also coordinate junior merchandisers. Specific responsibilities highlighted on a Senior Mercha...
customermanagementstorereportsperformanceresearchservicelinesalesdevelopmentmarketretailinventoryknowledgeproduct

Recruitment Business Partner
NEW ERA LIFE CARE PRIVATE LIMITED 17.00 to 23.00 Years Chennai,Bangalore, Ongole, Noida, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

We are looking for a Recruitment Business Partner to join our HR department and help develop and implement successful recruiting strategies. Recruitment Business Partner responsibilities include...
customerbusinessmanagementanalyticsperformanceserviceengagementhealthcareexcellentresourcesemployeehumaninterpersonalprojectobjectivesservices

Medical Office Manager
ICELAND FROZEN FOODS 15.00 to 25.00 Years Chennai,Bangalore, Hyderabad, Gurugram, Delhi 29 Oct, 2024

Medical Office Managers are responsible for the non-clinical aspects of a health care institution, such as human resources, budgeting, supplies, and customer service. A typical resume example for...
immunohematologymedical equipmentmedical microbiologyofficemedical transcriptionclinical microbiologytransfusion medicinemedical billingmedical officemedical

Java Architect
UST Global 12.00 to 22.00 Years Chennai,Kochi, Thiruvananthapuram 29 Oct, 2024

Java Architect Location: Chennai, Trivandrum,Kochi Notice: Immediate-30 Days We are seeking a highly experienced Java Architect with a proven track record in delivering large-s...
solution architecturejavasolution design

Digital Marketing Manager
Pneumatic Vacuum Elevators and Lifts-India Private Limited 3.00 to 8.00 Years Chennai 29 Oct, 2024

Job Title: Digital Marketing Manager - U.S. based Home Elevator Manufacturing company near Chennai. Job Summary - We are looking for a skilled Digital Marketing Manager to join our team - a l...
seodigital marketingcreative designinginternet researchinternet marketingonline lead generationcreative writingcreative optimization

All India Sales Manager
Pneumatic Vacuum Elevators and Lifts-India Private Limited 3.00 to 8.00 Years Chennai 29 Oct, 2024

All India Sales Manager - Home Elevators Location: near Chennai Job Summary: We are seeking an experienced All India Sales Manager to lead our sales efforts for home elevators across the count...
sales processlead generationbusiness developmentmarketing automation

Sap Abap Developer
ARYAN TECHNOLOGY 0.00 to 4.00 Years Chennai,Bangalore, Noida, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

Responsibilities:

Develop and maintain SAP design and technical specification documents, and conduct unit, integration and release testing to validate fun...
client administrationenhancement pointsabap-oosap basissap abapbasis administrationsap

Hr Recruiter
ARYAN TECHNOLOGY 1.00 to 6.00 Years Chennai,Bangalore, Noida, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City, Delhi 29 Oct, 2024

HR Officer Responsibilities:

Preparing job descriptions, advertising vacant positions, and managing the employment process.

Orientatin...
hr operationshr analyticspayroll

Business Consultant
M/S AASTHA LIFECARE CORPORATION PRIVATE LIMITED 15.00 to 24.00 Years Bangalore,Mangalore, Anantnag, Latehar, Sheopur, Hyderabad, Kolkata, Gurugram, Ujjain, Pathanamthitt 29 Oct, 2024

We are looking for a qualified and motivated business consultant to assess and reform business operations, provide expert guidance, and implement projects. The business consultants responsibiliti...
analysisstrategyconsultingplanningbusinessdevelopmentmanagementmarketingstrategic

Assistant Manager
AES INDUSTRIAL PRIVATE LIMITED 5.00 to 10.00 Years Bangalore,China, Bangladesh, Qatar, South Africa, Port Blair, South Korea, Iraq, Sri Lanka, Chennai, 29 Oct, 2024

We are looking for a responsible Assistant Manager to help organize and run our retail stores and fill in for thewhen needed. Your job will be highly important in ensuring the sales team meets it...
assistant workmanager self-service

Development Director
NEW ERA LIFE CARE PRIVATE LIMITED 22.00 to 0.00 Years Bangalore,Chennai, Noida, Hyderabad, Kolkata, Gurugram, Pune, Dhubri, Mumbai City, Delhi 29 Oct, 2024

We are looking for a person who is as passionate and enthusiastic about our organizations mission as we are, someone with an understanding of the importance this work has in driving change in com...
marketingroidigitalservicebusinessdevelopmentoversightcustomermanagementgenerationexcellentpatientsleadprojectprofessional

Hardware Engineer
Team Technology 5.00 to 8.00 Years Bangalore 29 Oct, 2024

We are seeking a highly skilled M.Tech Hardware Engineer with expertise in Board Design, Testing, and Application Development. The ideal candidate will have a pr...
microcontrollerstestinghardware designdocumentation

Ship Engineer
M/S AASTHA LIFECARE CORPORATION PRIVATE LIMITED 8.00 to 13.00 Years Bangalore,Chandrapur, Uttar Bastar Kanker, Chennai, Hyderabad, Kasargod, South Goa, Bhavnagar, Silva 29 Oct, 2024

We are looking for a precise marine engineer to manage the development of multiple maritime projects. In this role, you will oversee the research, design, and construction of marine vessels, infr...
warehouse operationsforklift operationoperations managementinventory managementlogistics managementsupply chain managementshippingwarehouse management systemsreceiving

HR Business Partner
NEW ERA LIFE CARE PRIVATE LIMITED 19.00 to 25.00 Years Bangalore,Chennai, Noida, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City, Delhi, Itanagar 29 Oct, 2024

We are looking for a qualified HR business partner to oversee all human resources operations and ensure theyre aligned with our business goals. Our ideal candidates should have solid experience ...
planningengagementbusinesshrbphrisdevelopmentobjectivesexcellentworkforceinterpersonaleffectivenessorganizationalemployee

SharePoint development Support FullStac wit Net Blore Mumbai
WHITE HORSE MANPOWER CONSULTANCY (P) LTD 10.00 to 15.00 Years Bangalore,Mumbai City 29 Oct, 2024

Demonstration of the capabilities of SharePoint in Digital domain. Microsoft SharePoint Server 2010/2013/2016/2019 Exp .NET Web appl or integrating .NET applications in SharePoint, CSS and SQL ...
javascriptxml

Customer Support Specialist
IZEE MANPOWER CONSULTANCY PVT LTD 1.00 to 6.00 Years Bangalore,Pune 29 Oct, 2024

Hiring for leading Call Centers/BPOs for Freshers/Experienced fr Customer//Tech Profile with Salary upto 6.5 Lacs P.A!Cal @ hidden_mobile// customer servicecustomer process

Business Development
Ginger Media Group 2.00 to 7.00 Years Bangalore 29 Oct, 2024

Job Title: Business Development Manager (Sales) Role Definition: Business Development (Sales) Manager would be primarily responsible to attracting new business clients through different sales c...
b2b marketingb2b salesbusiness development

Community Marketing
SAIKOR SECURITY TRAINING AND SERVICES PRIVATE LIMITED 18.00 to 25.00 Years Bangalore,Noida, Chennai, Kolkata, Gurugram, Pune, Mumbai City, Delhi, Other AndamanNicobar, Port Bl 29 Oct, 2024

We are looking for a Director of Customer & Community Marketing to spearhead our community-building and customer engagement efforts. In this role, you will be responsible for creating and nurtur...
servicesupportdeliverylogisticsdevelopmentcommunicationcustomersalesprocessmanagementskillsemployeesatisfactioncontinuousautoimprovement

Store Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 7.00 Years Bangalore,Noida, Chennai, Hyderabad, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

Job description Responsibilities Timely opening of Store and adherence to all the processes at store opening Optimum utilization of manpower & ...
team managementinventory managementproduction

Technical Account Manager
LEADZN PRIVATE LIMITED 6.00 to 11.00 Years Bangalore,Zimbabwe, Mozambique, Afghanistan, Chennai, Noida, Hyderabad, Kolkata, Gurugram, Pune, Mum 29 Oct, 2024

We are looking for a qualified Technical account manager to oversee and address our customers technical needs. You will provide accurate technical service before and after the point of sale, ensu...
electrical maintenanceconstruction engineeringcranecenterpetroleumsupportdesktopproductionconstructionplanneroperatortechniciancallprojectmanagerelectronic

Office Assistant
LEADZN PRIVATE LIMITED 6.00 to 11.00 Years Bangalore,Chennai, Noida, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City, Delhi 29 Oct, 2024

We are looking for a competent Office Assistant to help with the organization and running of the daily administrative operations of the company.
What does an office assistant do
The i...
yield managementschedulingoperationsfrontofficesales coordinationfront office managementsalesdevelopmentbusinessmanagersupervisorproposalaccount

HR Manager - Compensation and Benefits
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 9.00 Years Bangalore,Chennai, Noida, Hyderabad, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

Responsibilities

Design compensation and benefits packages

Implement performance review procedures (e.g. quarterly/annual and 360 evaluations)

Develop fair HR po...
executioncommunication skillsstrategyadvisingcreation

Community Marketing
SAIKOR SECURITY TRAINING AND SERVICES PRIVATE LIMITED 18.00 to 25.00 Years Bangalore,Noida, Chennai, Kolkata, Gurugram, Pune, Mumbai City, Delhi, Other AndamanNicobar, Port Bl 29 Oct, 2024

We are looking for a Director of Customer & Community Marketing to spearhead our community-building and customer engagement efforts. In this role, you will be responsible for creating and nurtur...
servicesupportdeliverylogisticsdevelopmentcommunicationcustomersalesprocessmanagementskillsemployeesatisfactioncontinuousautoimprovement

Business Development Executive
MEDI TRANSCARE PRIVATE LIMITED 1.00 to 6.00 Years Bangalore 29 Oct, 2024

HI, We have a vacancy for leading MNC medical devices company on Medi Transcare employent. Designation: BDE Location: Bangalore/ Bengaluru JOB Description

Mee...
sellingsalescommunicationpharmadevices

Hr Generalist
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 5.00 to 9.00 Years Bangalore,Noida, Chennai, Hyderabad, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

Responsibilities

Administer compensation and benefit plans

Assist in talent acquisition and recruitment processes

Conduct employee onboarding and help organize t...
inductionhr coordinationemployee orientationhr assistanceattendance managementemployee engagementjoining formalitieshr generalist

Bpo Executive
IZEE MANPOWER CONSULTANCY PVT LTD 0.00 to 4.00 Years Bangalore 29 Oct, 2024

Dear THIS IS JANVI FROM IZEE MANPOWER I hope this message finds you well. We are excited to announce an excellent career opportunitys , in leading (MNC) COMPANIES for (BPO). We are currently se...
international call centerinternational voice

Child Life Specialist
NEW ERA LIFE CARE PRIVATE LIMITED 11.00 to 21.00 Years Bangalore,Chennai, Noida, Nellore, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City, Delhi 29 Oct, 2024

We are looking for a Child Life Specialist to join our team and help our pediatric patients have a more relaxing and effective recovery time while in our healthcare facility. Child Life Speciali...
collaborationleadershipcommunicationadvocacytherapydevelopmentpatienceemotionalservicesfamilylifeempathychildplayengaging

Demand Generation Manager
SAIKOR SECURITY TRAINING AND SERVICES PRIVATE LIMITED 18.00 to 25.00 Years Bangalore,Noida, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi, Port Blair 29 Oct, 2024

We are looking for a Demand Generation Manager to develop and implement strategies to generate leads and revenue for the company. You will be responsible for working closely with the sales and m...
servicetelemarketinginsurancedigitalgoodappointmentsbusinesscrmdevelopmentcommunicationcustomersalesmarketingoutboundgenerationcallslife

Quality Control Manager
OVERNET TRADING PRIVATE LIMITED 24.00 to 25.00 Years Bangalore,Raipur, Vapi, Hyderabad, Gurugram, Mumbai City, Mahesana, Delhi, Vasco Da Gama, Khagaria 29 Oct, 2024

We are looking for a detail-oriented quality control manager to ensure the manufacturing production lines run smoothly and generate a consistently suitable output of products that meet quality an...
salestechgeneralqualityseniorprocurementcontrolequipmentproduction headsupervisoroperatorelectricalinstrumentmanager

Business Development Manager
NEEDION SOLUTIONS PRIVATE LIMITED 1.00 to 4.00 Years Bangalore,Guntur, Rajahmundry, Chennai, Kurnool, Nellore, Hyderabad, Guntakal, Kakinada, Anantpur 29 Oct, 2024

Vacancies for Leading Insurance companies Apply for the job to get relevant call backs Roles && Responsibilities: Team Management and Development Responsible for maintaining a culture of fairn...
marketinginsurance brokingsalesagency channelagency salesagency managementbusiness developmentinsurance sales

Assistant Finance Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 3.00 to 7.00 Years Bangalore,Noida, Chennai, Hyderabad, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

Job description

Developing an understanding of the strategies that drive our growth, you will be at the forefront of how we evolve to meet our goals. We have Finance Business Part...
payrollsupply chainprocurementrisk managementcustomer developmentforecastingfinancial reportinganalytical

Quality Manager
LEADZN PRIVATE LIMITED 6.00 to 11.00 Years Bangalore,Zimbabwe, Mozambique, Chennai, Noida, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Gha 29 Oct, 2024

We are looking for an experienced Quality Manager to ensure that our products and services meet all necessary requirements before they reach the consumer. The Quality Manager, or Quality Assura...
operationsresearchbudgetlogisticsqualitybudget analysismanagementadministratorcontrollershiftassistantanalystprojectsupervisorassociateofficer

Buyer (Commodity)
DOMNIC LEWIS PRIVATE LIMITED 3.00 to 7.00 Years Bangalore,Chennai 29 Oct, 2024

This role involves collaborating with global and regional teams to drive strategic purchasing initiatives and ensure the efficient, sustainable, and innovative management of the supply chain. Thi...
supplier managementcontractspurchaseindirectrenovationcontrolcapexcostconstructioncommodityglobal

Project Engineer
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 8.00 Years Bangalore,Chennai, Noida, Hyderabad, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

Prepare, schedule, coordinate, monitor, and control assigned engineering projects to ensure timely completion and quality delivery.

Monitor compliance with applica...
negotiationsite managementcivil engineeringengineeringleadershipsite executionautocadproject managementsite supervision

Bio-tech Research Associate / Scientist
NEW ERA LIFE CARE PRIVATE LIMITED 2.00 to 7.00 Years Bangalore,Iran, Zimbabwe, Mozambique, Jaipur, Iraq, Chennai, Noida, Hyderabad, Kolkata, Lebanon, Gur 29 Oct, 2024

We are looking for a Biologist to join our team and conduct research and experiments to gain a better understanding about different biological organisms in nature. Biol...
sciencebiochemical engineeringresearch analysisbioprocessingmicrobiologybiochemistryneurostimulationmicrobiological analysisbiologics

PREV
NEXT

human resources development Job Openings

Job description Developing an understanding of the strategies that drive our growth, you will be at the forefront of how we evolve to meet our goals. We have Finance Business Part... payrollsupply chainprocurementrisk managementcustomer developmentforecastingfinancial reportinganalytical

... six sigmaqms

Responsibilities:

HR Officer Responsibilities:

Job description Responsibilities Timely opening of Store and adherence to all the processes at store opening Optimum utilization of manpower & ... team managementinventory managementproduction

What does an office assistant do

Responsibilities Design compensation and benefits packages Implement performance review procedures (e.g. quarterly/annual and 360 evaluations) Develop fair HR po... executioncommunication skillsstrategyadvisingcreation

Responsibilities Administer compensation and benefit plans Assist in talent acquisition and recruitment processes Conduct employee onboarding and help organize t... inductionhr coordinationemployee orientationhr assistanceattendance managementemployee engagementjoining formalitieshr generalist

Job description Developing an understanding of the strategies that drive our growth, you will be at the forefront of how we evolve to meet our goals. We have Finance Business Part... payrollsupply chainprocurementrisk managementcustomer developmentforecastingfinancial reportinganalytical

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Job description

Developing an understanding of the strategies that drive our growth, you will be at the forefront of how we evolve to meet our goals. We have Finance Business Part...
payrollsupply chainprocurementrisk managementcustomer developmentforecastingfinancial reportinganalytical

...
six sigmaqms

Job description Responsibilities Timely opening of Store and adherence to all the processes at store opening Optimum utilization of manpower & ...
team managementinventory managementproduction

Responsibilities

Design compensation and benefits packages

Implement performance review procedures (e.g. quarterly/annual and 360 evaluations)

Develop fair HR po...
executioncommunication skillsstrategyadvisingcreation

Responsibilities

Administer compensation and benefit plans

Assist in talent acquisition and recruitment processes

Conduct employee onboarding and help organize t...
inductionhr coordinationemployee orientationhr assistanceattendance managementemployee engagementjoining formalitieshr generalist

Job description

Developing an understanding of the strategies that drive our growth, you will be at the forefront of how we evolve to meet our goals. We have Finance Business Part...
payrollsupply chainprocurementrisk managementcustomer developmentforecastingfinancial reportinganalytical