it support jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

it support Job Openings

Showing 34051 - 34100 of 52340 Jobs

Accounts Payable

AVS MANPOWER CONSULTANCY PRIVATE LIMITED 1.00 to 6.00 Years Mumbai City 02 Nov, 2024

Hiring on urgent basis for following

Job Title:

Reports to:

Job Summary:

Accounts Executive

NEW ERA LIFE CARE PRIVATE LIMITED 2.00 to 7.00 Years Mumbai City,Pune, Benin, Tawang, Qatar, Bangalore, Noida, Chennai, Sri Lanka, Hyderabad, Gurugram, K 02 Nov, 2024

Hiring for Home Underwriter Leading General Insurance Co_ Mumbai

RightMatch HR Services Pvt Ltd 10.00 to 20.00 Years Mumbai City 02 Nov, 2024

Company

Role

Location

Work

Industry Prefer...
underwriting

Virtual Relationship Manager
Bayleaf HR Solutions Pvt Ltd 1.00 to 3.00 Years Mumbai City 02 Nov, 2024

! We are hiring for Leading AMC Company ! Designation:-Virtual Business In-Charge Location:-Mumbai ( Andheri ) Need Candidates from Western line CTC :- Up to 4.20 LPA portfolio managementnismhigh net worth individualsmutual fundsinvestment bankingvrminvestment advisoryinvestment products

Office Boy
MARLEX PRODUCTS LIMITED 1.00 to 2.00 Years Mumbai City 02 Nov, 2024

Key Responsibilities:

Cleaning & Housekeeping:

Maintain the cleanliness of the entire office area, including floors, desks, and restrooms. cleaninghousekeeping

Community Marketing
SAIKOR SECURITY TRAINING AND SERVICES PRIVATE LIMITED 18.00 to 25.00 Years Mumbai City,Pune, Bangalore, Noida, Chennai, Kolkata, Gurugram, Delhi, Other AndamanNicobar, Port Bl 02 Nov, 2024

We are looking for a Director of Customer & Community Marketing to spearhead our community-building and customer engagement efforts. In this role, you will be responsible for creating and nurtur...
servicesupportdeliverylogisticsdevelopmentcommunicationcustomersalesprocessmanagementskillsemployeesatisfactioncontinuousautoimprovement

Lead Electrical Engineer
DOMNIC LEWIS PRIVATE LIMITED 5.00 to 8.00 Years Mumbai City 02 Nov, 2024

Domnic Lewis is mandated to hire for Electrical Design role at Thane location Must Have: We are preferring candidates who are having experience in Shipping/Marine Rol...
etapcable traymctlayout preparation

Network Engineer
Axycube Solutions Pvt Ltd 5.00 to 9.00 Years Mumbai City 02 Nov, 2024

Roles and Responsibilities:

Day 1 head end configuration for all new SDWAN CPE.

Modification/Creati...
firewallsdwan

Interior design engineer
Obox HR Solutions 3.00 to 8.00 Years Navi Mumbai,Mumbai City, Thane 02 Nov, 2024

Position: Interior design engineer Working Days: Mon-Sat Working Time: 8:30 AM 5:30 PM Location: Govandi Work Mode: Work from...
v-rayinterior designingsketchupinterior architecture

HR Assistant Part Time
IMPACT HR AND KM SOLUTIONS 0.00 to 1.00 Years Mumbai City,Pune, Nashik, Dhule 02 Nov, 2024

Back Office Executive- Part Time,Fresher,Students Only,Noon Shift/ Morning Shift
IT E mail, Computer, Excel, Word, MS- CIT Certificates Communication Oral and Written English, Marathi, ...
hr operationshrishr consultingsystemshr analyticsjoining formalitieshumanresources

Vlocity Lead / Architect
Wroots Global Private Limited 10.00 to 18.00 Years Mumbai City,Pune, Bangalore, Hyderabad 02 Nov, 2024

Role :Salesforce Vlocity Lead / Architect Requirements:

salesforceomniscriptexpertisedataraptorvlocity

Sap Abap Developer
ARYAN TECHNOLOGY 0.00 to 4.00 Years Mumbai City,Pune, Bangalore, Noida, Chennai, Hyderabad, Kolkata, Gurugram, Delhi 02 Nov, 2024

Responsibilities:

Develop and maintain SAP design and technical specification documents, and conduct unit, integration and release testing to validate fun...
client administrationenhancement pointsabap-oosap basissap abapbasis administrationsap

SharePoint development Support FullStac wit Net Blore Mumbai
WHITE HORSE MANPOWER CONSULTANCY (P) LTD 10.00 to 15.00 Years Mumbai City,Bangalore 02 Nov, 2024

Demonstration of the capabilities of SharePoint in Digital domain. Microsoft SharePoint Server 2010/2013/2016/2019 Exp .NET Web appl or integrating .NET applications in SharePoint, CSS and SQL ...
javascriptxml

Opportunity for Fresher in International BPO Voice
Varda HR LLP 0.00 to 4.00 Years Mumbai City 02 Nov, 2024

Opportunity for Fresher to start their Career into International BPO Location Mumbai Salary 15k to 45k Excellent Communication Skills required Graduate/HSC Fresher can also apply Shift: Rot...
uk processbpous processcustomer supportcustomer carecustomer servicevoice process

Electrical Engineer
AppSoft Solutions 1.00 to 6.00 Years Hyderabad,Bangalore, Chennai, Noida, Gurugram, Kolkata, Pune, Mumbai City, Delhi 02 Nov, 2024

Electrical Engineer Experienced, accomplished, self-motivated Electrical Engineer to maintain and support our industry-leading products and systems. The Electrical Engineer will work across a va...
autocadelectrical maintenancecadelectrical inchargeelectrical officerelectrical design engineer

Biology Teacher
Learning Planner Hiring For Minshe Academy and Animation 0.00 to 4.00 Years Hyderabad,Howrah, Bangalore, Chennai, Nadia, Kolkata, Hooghly, Mumbai City, Delhi, Ahmedabad 02 Nov, 2024

Teacher for CBSE and ICSE Boards
Position: Teacher (Full-Time/Part-Time) Roles and Responsibilities:

Teach subjects to students of class 10...
biological sciences/biomedical sciencescbsebiologycontent developmentteachingbio sciencescience teachingicsecontent writing

CANADIAN Project Required Highway Design Civil Engineer
IRANIAN CONSTRUCTION GROUP 7.00 to 12.00 Years Hyderabad,Canada, Guwahati, Ahmedabad, Bilaspur, Bhubaneswar, Bangalore, Chennai, Kochi, Pune, Dalho 02 Nov, 2024

Call Or Contact through WhatsApp to check on your eligibility. Document Officer Mr. Ramesh Tiwari- Eight NineZero Ze...
highway constructionhighway engineering

Channel Sales
Kavita Chandran Hiring For Client 4.00 to 8.00 Years Hyderabad,Kolkata, Mumbai City 02 Nov, 2024

We are seeking an experienced and dynamic Channel Sales Manager to lead and expand our sales efforts in the networking hardware sector. The ideal candidate will be responsible for building and ma...
crm databasesnegotiation skillscommunication skillsdistributor saleschannel sales

CANADIAN Project Required Project Engineer
IRANIAN CONSTRUCTION GROUP 7.00 to 12.00 Years Hyderabad,Canada, Other Himachal Pradesh, Ahmedabad, Bhubaneswar, Bangalore, Indore, Kochi, Chennai, 02 Nov, 2024

Call Or Contact through Whatsapp to check on your eligibility. Document Officer Mr. Ramesh Tiwari. Eight NineZero Zero Five Three Three Two T...
project engineeringproject planningengineering design

Branch Operations Manager
Easy Hiring Solutions 2.00 to 5.00 Years Hyderabad,Bangalore, Chennai, Indore, Raipur, Tiruchirappalli, South Goa, Dibang Valley, Tadepalligu 02 Nov, 2024

Branch Operations Managersoversee operational activities at every level of an organization. Their duties include hiring and training employees and managing quality assurance programs. An ...
collateral managementoperational risk managementbackend operationsback office managementback office supportoperations researchoperational riskoperations managementback office operations

Electrical Supervisor
The JSM Engineers 0.00 to 3.00 Years Hyderabad,Other Andhra Pradesh, Hospet, Pune, Mumbai City 02 Nov, 2024

Job Details:

Required Experience: 0-3 Yrs

Required Locations: Pune, Mumbai, Hyderabad, Hospet, Andhra Pradesh

Salary: 18hidd...
electrical engineeringsite engineeringsite integrationsite installationsite supervisiontechnical supportelectrical site engineeringelectrical maintenancetechnicianelectrical

Director, Operations
TEAMWORK CABLES PRIVATE LIMITED 15.00 to 25.00 Years Hyderabad,Kurnool, Austria, Canada, Amalapuram, Papum Pare, Anjaw, Machilipatnam, Tirap, Changlang, 02 Nov, 2024

Full job description About the Role The Director, Operations at AAD is responsible for guiding a t...
overseas marketingexperience operatingoversee manufacturingrole expectationsoversee customer technical

Medical Office Specialist
LEADZN PRIVATE LIMITED 10.00 to 20.00 Years Hyderabad,Bangalore, Noida, Chennai, Gurugram, Kolkata, Pune, Mumbai City, Delhi 02 Nov, 2024

We are looking for a highly capable and personable medical office specialist to assist us with day-to-day administrative tasks at our healthcare facility. In this role, you will be responsible fo...
pharmaceutical salesbusiness analyticspharmaceutical productionmarket basket analysislogistics coordinationschedulinghealthcare marketingsupportofficespecialistanalystcoordinatorspecia

Dialer Executive
EBIXCASH GLOBAL SERVICES PRIVATE LIMITED 1.00 to 2.00 Years Hyderabad,Bangalore, Pune 02 Nov, 2024

Good communication skills Working knowledge in excel & MySql/MSSql Should be able to identify the deviation in data behavior and correct it with proper corrective and preventive measures Minim...
dialerdialer supportgenesysconvox

International E-Commerce Chat Process
CGS 1.00 to 3.00 Years Hyderabad 02 Nov, 2024

Job Posting: International E-Commerce Chat Process Position: International E-Commerce Chat Process Work Schedule: 5 Days a Week (2 Week Offs) Location: Work from Office Int...
chat processinternational bpobpo non voiceinternational call centernon voice process

Kitchen Porter
AES INDUSTRIAL PRIVATE LIMITED 5.00 to 10.00 Years Hyderabad,China, Bangladesh, Qatar, South Africa, Port Blair, South Korea, Bangalore, Iraq, Sri Lank 02 Nov, 2024

We are looking for a Kitchen Porter to clean our kitchen and support our cooking staff. This is an entry-level job but if youre good at it, youll be invaluable in making sure our kitchen is alway...
time managementa fast learner with an interest in kitchen work

Development Director
NEW ERA LIFE CARE PRIVATE LIMITED 22.00 to 0.00 Years Hyderabad,Bangalore, Chennai, Noida, Kolkata, Gurugram, Pune, Dhubri, Mumbai City, Delhi 02 Nov, 2024

We are looking for a person who is as passionate and enthusiastic about our organizations mission as we are, someone with an understanding of the importance this work has in driving change in com...
marketingroidigitalservicebusinessdevelopmentoversightcustomermanagementgenerationexcellentpatientsleadprojectprofessional

Project Engineer
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 9.00 Years Hyderabad,Bangalore, Noida, Chennai, Gurugram, Pune, Mumbai City, Delhi 02 Nov, 2024

Responsibilities

Prepare, schedule, coordinate and monitor the assigned engineering projects

Monitor compliance to applicable codes, practices, QA/QC policies, perfo...
site executionleadershipproject managementengineeringautocadcivil engineeringsite supervision

Senior Customer Support Executive
Panzer Technologies Pvt Ltd 3.00 to 5.00 Years Hyderabad 02 Nov, 2024

Company Overview Shopmyuniform.com is a revolution in uniform retail. Our hybrid model leverages cutting-edge technology to seamlessly integrate smooth online shopping with exceptional walk-in cu...
decision-makingproblem solvingemphatetic

Financial Analyst
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 8.00 Years Hyderabad,Bangalore, Noida, Chennai, Gurugram, Pune, Mumbai City, Delhi 02 Nov, 2024

Develop Financial Models: Build and maintain complex financial models to forecast future financial performance, analyze investment opportunities, and assess potential ri...
advanced excelbank reconciliationoperationstds calculationfinancial reportingtallymis reporting procurementexcel report

Accounting Specialist
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 3.00 to 7.00 Years Hyderabad,Bangalore, Chennai, Noida, Gurugram, Pune, Mumbai City, Delhi 02 Nov, 2024

Check figures, postings, and documents for accuracy. Organize, secure, and maintain all files, records, cash and cash equivalents in accordance with policies and procedures. Record, store, access...
qualitybillingstandardsaccountingmentorfinancialfinance executivevendorauditing

Assistant Store Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 3.00 to 7.00 Years Hyderabad,Bangalore, Noida, Chennai, Gurugram, Pune, Mumbai City, Delhi 02 Nov, 2024

Responsibilities

Assist the Retail Store Manager in planning and implementing strategies to attract customers

Coordinate daily customer service operations (e.g. sales proc...
customer supportroot cause analysisanalyticalmonitoringchange managementcost controlcustomer satisfactionmanufacturing process

Hr Specialist
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 5.00 to 10.00 Years Hyderabad,Bangalore, Chennai, Noida, Gurugram, Pune, Mumbai City, Delhi 02 Nov, 2024

Support the automation of various HR processes and workflows to improve efficiency and reduce manual efforts.

Collaborate on system integrations between HR tools and...
internshipreport generationresearchautomationhr processesfocushr policies

Sap Abap Developer
ARYAN TECHNOLOGY 0.00 to 4.00 Years Hyderabad,Bangalore, Noida, Chennai, Kolkata, Gurugram, Pune, Mumbai City, Delhi 02 Nov, 2024

Responsibilities:

Develop and maintain SAP design and technical specification documents, and conduct unit, integration and release testing to validate fun...
client administrationenhancement pointsabap-oosap basissap abapbasis administrationsap

Insurance Sales Manager
BWISE SOLUTIONS PRIVATE LIMITED 1.00 to 6.00 Years Gurugram,Delhi, Indore, Mumbai City, Bhopal 02 Nov, 2024

Exceed recruitment target on new agency leaders and agent enrolments. Enhance quantity and quality recruitment by developing successful leaders. Emphasis on quality recruitment by the Distribut...
insurance salescommunication skillsteam managementhandlingteam buildingconvincing powerhealth insurance

Customer Support Specialist
Future Plannerz Hiring For International BPOs and Captive Units 1.00 to 6.00 Years Gurugram,Delhi, Noida 02 Nov, 2024

Job Openings for International BPOs and Captive Units Available Profiles:

Travel Voice

Telecom Voice & Sales

US Collections
...
sales processdigital salesinternational salesinternational bpovoice processinternational call centerdigital marketingcustomer service

Managing Partner
Privilege Consultant 2.00 to 7.00 Years Gurugram,Delhi, Ghaziabad, Noida, Rohtak, Varanasi, Kanpur, Agra 02 Nov, 2024

LOCATION: DELHI NCR( karkarduma, Jhandelwalan, Ghaziabad, Noida) Rohtak, Agra, kanpur, varanasi SEGMENT HIRING: Experience: Life Insu...
salesbusiness developmentdirect salesmarketing

Electrical Engineer
AppSoft Solutions 1.00 to 6.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 02 Nov, 2024

Electrical Engineer Experienced, accomplished, self-motivated Electrical Engineer to maintain and support our industry-leading products and systems. The Electrical Engineer will work across a va...
autocadelectrical maintenancecadelectrical inchargeelectrical officerelectrical design engineer

Associate Agency Manager
KKD Consulting Hiring For CLIENTS 1.00 to 6.00 Years Gurugram,Faridabad, Hisar, Karnal, Kurukshetra, Rohtak, Panchkula, Ambala, Mohali, Chandigarh 02 Nov, 2024

Job Title: Agency Development Manager Location:Pan India Job Type: Full-time About Us: were on the lookout for an Agency De...
upsellingsalesdirect salescredit card salesoutside salesbankingbusiness development

Inside Sales Executive
Jobs Territory 0.00 to 4.00 Years Gurugram 02 Nov, 2024

We are seeking a motivated and dynamic Forex Sales Consultant to engage with prospective customers seeking foreign exchange products. The ideal candidate will act as a trusted consultant, underst...
telemarketing salesb2b salesinside salescommunication skillsgraduatedirect salescorporate salescross selling

Graduate Engineer Trainee
VANTEK INDIA ASSOCIATES Fresher Gurugram,Delhi, Noida 02 Nov, 2024

Graduate Engineer (Fresher) Location:Delhi / NCR We are seeking a motivated and enthusiastic Graduate Engineer to join our team. This is an entry-level positio...
testingproduction

Senior Civil Engineer
LEADZN PRIVATE LIMITED 10.00 to 20.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 02 Nov, 2024

We are looking for a highly capable senior civil engineer to manage our construction projects. You will be conducting land surveys, allocating resources, supervising multidisciplinary constructio...
caseconstruction managementexecutive office administrationsenior administrationofficetechnical supportengineering managementsciencemarketingresearchclinicalassistantexecutiveproducerregionalmanagersocialmedical

Regional Sales Manager
NEW ERA LIFE CARE PRIVATE LIMITED 5.00 to 10.00 Years Gurugram,Delhi, Noida, Benin, Tawang, Qatar, Bangalore, Sri Lanka, Chennai, Hyderabad, Kolkata, Pune 02 Nov, 2024

We are looking for a Regional Sales Manager to expand our customer base and achieve sales quotas for specific districts of our company. To be successful in this role, you should have previous ex...
customerplanningadaptabilityleadershipcommunicationtimenegotiationproblemmanagementsalesrelationshipserviceskillsflexibilitysolving

Medical Office Specialist
LEADZN PRIVATE LIMITED 10.00 to 20.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 02 Nov, 2024

We are looking for a highly capable and personable medical office specialist to assist us with day-to-day administrative tasks at our healthcare facility. In this role, you will be responsible fo...
pharmaceutical salesbusiness analyticspharmaceutical productionmarket basket analysislogistics coordinationschedulinghealthcare marketingsupportofficespecialistanalystcoordinatorspecia

Shipping Supervisor
BHA FOODS PRIVATE LIMITED 15.00 to 25.00 Years Gurugram,Delhi, Noida, Bangladesh, Shimla, Bangalore, Chennai, Philippines, Nepal, Hyderabad, Kolkat 02 Nov, 2024

Responsibilities

Oversee daily shipping operations to ensure timely and accurate deliveries.

Manage and supervise the shipping team,...
dock equipmentfreight brokerageshippingpallet rackingforklift trainingshipping lineshippers

Technical Account Manager
LEADZN PRIVATE LIMITED 6.00 to 11.00 Years Gurugram,Delhi, Noida, Zimbabwe, Mozambique, Afghanistan, Bangalore, Chennai, Hyderabad, Kolkata, Pu 02 Nov, 2024

We are looking for a qualified Technical account manager to oversee and address our customers technical needs. You will provide accurate technical service before and after the point of sale, ensu...
electrical maintenanceconstruction engineeringcranecenterpetroleumsupportdesktopproductionconstructionplanneroperatortechniciancallprojectmanagerelectronic

Child Life Specialist
NEW ERA LIFE CARE PRIVATE LIMITED 11.00 to 21.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Nellore, Hyderabad, Kolkata, Pune, Mumbai City 02 Nov, 2024

We are looking for a Child Life Specialist to join our team and help our pediatric patients have a more relaxing and effective recovery time while in our healthcare facility. Child Life Speciali...
collaborationleadershipcommunicationadvocacytherapydevelopmentpatienceemotionalservicesfamilylifeempathychildplayengaging

Accounts Executive
NEW ERA LIFE CARE PRIVATE LIMITED 2.00 to 7.00 Years Gurugram,Delhi, Noida, Benin, Tawang, Qatar, Bangalore, Chennai, Sri Lanka, Hyderabad, Kolkata, Pune 02 Nov, 2024

We are looking for a competent Account Executive to find business opportunities and manage customer relationships. Youll be directly responsible for the preservation and expansion of our customer...
negotiationtimemanagementplanningsalesproblemcommunicationinterpersonalsolvingskillsdetailaccountstrategicorganizationalattention

Development Director
NEW ERA LIFE CARE PRIVATE LIMITED 22.00 to 0.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Dhubri, Mumbai City 02 Nov, 2024

We are looking for a person who is as passionate and enthusiastic about our organizations mission as we are, someone with an understanding of the importance this work has in driving change in com...
marketingroidigitalservicebusinessdevelopmentoversightcustomermanagementgenerationexcellentpatientsleadprojectprofessional

Project Engineer
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 9.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 02 Nov, 2024

Responsibilities

Prepare, schedule, coordinate and monitor the assigned engineering projects

Monitor compliance to applicable codes, practices, QA/QC policies, perfo...
site executionleadershipproject managementengineeringautocadcivil engineeringsite supervision

PREV
NEXT

it support Job Openings

Back Office Executive- Part Time,Fresher,Students Only,Noon Shift/ Morning Shift

Responsibilities:

Teacher for CBSE and ICSE Boards

Full job description About the Role The Director, Operations at AAD is responsible for guiding a t... overseas marketingexperience operatingoversee manufacturingrole expectationsoversee customer technical

Responsibilities Prepare, schedule, coordinate and monitor the assigned engineering projects Monitor compliance to applicable codes, practices, QA/QC policies, perfo... site executionleadershipproject managementengineeringautocadcivil engineeringsite supervision

Responsibilities:

Responsibilities Oversee daily shipping operations to ensure timely and accurate deliveries. Manage and supervise the shipping team,... dock equipmentfreight brokerageshippingpallet rackingforklift trainingshipping lineshippers

Responsibilities Prepare, schedule, coordinate and monitor the assigned engineering projects Monitor compliance to applicable codes, practices, QA/QC policies, perfo... site executionleadershipproject managementengineeringautocadcivil engineeringsite supervision

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Full job description About the Role The Director, Operations at AAD is responsible for guiding a t...
overseas marketingexperience operatingoversee manufacturingrole expectationsoversee customer technical

Responsibilities

Prepare, schedule, coordinate and monitor the assigned engineering projects

Monitor compliance to applicable codes, practices, QA/QC policies, perfo...
site executionleadershipproject managementengineeringautocadcivil engineeringsite supervision

Responsibilities

Oversee daily shipping operations to ensure timely and accurate deliveries.

Manage and supervise the shipping team,...
dock equipmentfreight brokerageshippingpallet rackingforklift trainingshipping lineshippers

Responsibilities

Prepare, schedule, coordinate and monitor the assigned engineering projects

Monitor compliance to applicable codes, practices, QA/QC policies, perfo...
site executionleadershipproject managementengineeringautocadcivil engineeringsite supervision