Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
) Custom development of WPF GUI components. ) Working with web service developer to bind the GUI with relevant services. ) Active role in the design, development, testing and delivery of the overa...
objectdatastructuresproblemsolvingdesignpatternsversioncontrolnetwpftfsguiiocmvvmbindagiledesigntestingwindowsdesktoppatternenteddesignframewkdesignCustom development of WPF GUI components. ) Working with web service developer to bind the GUI with relevant services. ) Active role in the design, development, testing and delivery of the overall...
objectunittestingdatastructuresproblemsolvingdesignpatternsversioncontrolwpfdevelopmentagilemethodologiescommunicationskillswpftfsguiiocenteddesignwindowsfframewkdesignCustom development of WPF GUI components. ) Working with web service developer to bind the GUI with relevant services. ) Active role in the design, development, testing and delivery of the overall...
objectunittestingdatastructuresproblemsolvingdesignpatternsversioncontrolwpfdevelopmentagilemethodologiescommunicationskillswpftfsguiiocenteddesignwindowsfframewkdesignRole/ Responsibility: The primary functions of this role are to define and implement procedures for testing applications. Prepare samples, perform testing, analyze data, prepare written reports, and c...
testcasesregressiontestingautomationjavalifecyclewebserversdefectloggingdesignpatternstestautomationdesigndevelopmenttingtestautomationframewejavaframewkdesignapplicationser" Network Support Engineer will be responsible for configuration and execution of network changes on internal and customer facing network (routing and switching) infrastructure and application (firew...
protocols ciscoasa itservices steadystate ciscorouters globaldelivery audiomastering etw kdesign" Network Support Engineer will be responsible for configuration and execution of network changes on internal and customer facing network (routing and switching) infrastructure and application (firew...
protocols ciscoasa itservices steadystate ciscorouters globaldelivery audiomastering etw kdesign" Network Support Engineer will be responsible for configuration and execution of network changes on internal and customer facing network (routing and switching) infrastructure and application (firew...
protocols ciscoasa itservices steadystate ciscorouters globaldelivery audiomastering etw kdesign" Network Support Engineer will be responsible for configuration and execution of network changes on internal and customer facing network (routing and switching) infrastructure and application (firew...
protocols ciscoasa itservices steadystate ciscorouters globaldelivery audiomastering etw kdesignBe the Product & Service owner for Network Tranport Services Develop a Strategy and roadmap for Network Transport Services Proactively researches and identifies new WAN/LAN transport technologies an...
ciscobgptroubleshootingswitchesrootcauseanalysisrootcausecostreductioncustomerfocusciscocertifiedproblemanalysisetwkingciscocertifiedinternetwkexpertnetwkdesignnetwkautomationBe the Product & Service owner for Network Tranport Services Develop a Strategy and roadmap for Network Transport Services Proactively researches and identifies new WAN/LAN transport technologies an...
ciscobgptroubleshootingswitchesrootcauseanalysisrootcausecostreductioncustomerfocusciscocertifiedproblemanalysisetwkingciscocertifiedinternetwkexpertnetwkdesignnetwkautomationAbout Accenture: Accenture Technology powers our clients businesses with innovative technologies established and emerging changing the way their people and customers experience work, life and e...
clientrelationshipmanagementriskmanagementproblemsolvingchangemanagementclientmanagementprojectmanagementclientrelationshipcommunicationskillsramewkdesigndinationskills
In this role you will help design team to achieve its vision To be the Worlds best Customer Consultancy Solution & Integration team We enable BT to do good business, by focussing on three key areas: T...
lansitevisiowandeliverymsvisiomsofficeitservicesriskanalysistechnicaldesignmissioncriticalatanetwnetwkdesignnetwkdevicesOur purpose is to use the power of communications to make a better world. For each other, for our customers, for society and our communities. We need you to help us do this. Why this role matters lansitevisiowandeliverymsvisiomsofficeitservicesriskanalysistechnicaldesignmissioncriticalatanetwnetwkdesignnetwkdevices
Title: Advanced Services Engineer 4 Role: Design Validation testing for Financial Services Customer. Location: Bangalore Reporting to the Customer Service Lead, the Design Validation Test Engine...
testcasescustomerservicewebtechnologieswebapplicationsdesignunipernetwksproductslayer2tune100leveldesignpublicsectnetwkdesignsecondaryskillstechnicalsuppproductptfolioMinimum 1+ Year of experience in Testing Build scalable automated test frameworks and test suites working across technologies Participate in design and code inspections Perform manual testing, the ...
testexecutionautomationscriptinglanguagesmailscrumhiringjavaqualityteststrategysoftwaredevelopmenttestplanningestframewkdesignAbout Medline: Medline is Americas largest privately held national manufacturer and distributor of health care supplies and services. Today , Medline manufactures and distributes more than 550 , ...
testcasesautomationemcscriptingloadrunnerwebservicestestscriptssmoketestingmanualtestingagileenvironmenttingcontinuousimprovementfacilitationsoapuisoftwarequalityframewkdesignmicExecute and/or assist in all aspects of site planned and unplanned maintenance activities. Maintain network and security toolsets Monitoring, troubleshooting, and supporting the global network and sec...
auditservicedeskindustrysystemmanagementwirelesstcpipsystemadministrationnodeaccesscontrolsoftwaretestingccnaiosetwkadministrationnetwkdesignadministrationExp. 1- 4 Years Disha Outsourcing Online Job Portal Key Skills - POS software understanding Web and Mobile technologies and experience of .net Sound expertise in security and network design as we...
ithardwarefiletransferknowledgebaseapplicationserverpreventivemaintenancepospanlcdchatsounddesignmobiletalcinemadesktoploggingpremieretwkdesignapplicationsuppJob Title: It Head (transportation Industry) experience: Minimum of 15- 20 Years of Experience in a Similar Profile. location: Mumbai education: Be with Mba role: Responsible for the Overall Proj...
supplychainmanagementsupplychainprojectmanagementlogisticsplanningoperationsresearchdesignsupplyteachingresearchstrategyplanningdispatchschedulelogisticsmanagementetwkdesigninventoperatio1 Asst Manager - Admin (male) for A Reputed Telecom infrastructure company under company payroll. job Location will be guwahati Eligibilty Criteria - - - Minimum 2 - 4 year experience in Admininst...
opticalfiberhrassistancetelecominfrastructureinfrastructuredevelopmentofcmsoetwkdesignDell creates technology solutions for a changing world. Our Information Technology (IT) Architecture team translates our customers business requirements into total enterprise-wide solutions. It takes ...
javasqljavascriptsqlserverjquerysoftwaredevelopmentlifecyclewebservicesproductlaunchtestautomationcleagileplmproductlifecyclemanagementacleagilebonusprogramsframewkdesign
265982BR Engineering Expert - Network Production Job Description Responsible for design and implementation of infrastructure security solutions. Provide engineering to operate and support mission c...
sharedservicescustomerservicecomputersciencendoflifesoftwaredefinednetwkingfmradioitservicesitilprocessservicelinesnetwkdesignchangecontrolmonthlyrepmanagedservicesprojectd265984BR Engineering Expert - Network Design Job Description Design , install and support Local Area Networks & Wide Area Networks solutions to fulfill business requirements gathered by Global IT I...
sharedservicescustomerservicecomputerscienceprojectdeliveryitinfrastructureoftwaredefinednetwkinglifecycleservicelinesnetwkdesignbuildautomationmanagedservicesdailyoperationsservicepPromote the innovation culture; Develop and implement plans to support and grow the Innovation Program. Participate in designing and implementing Technical Innovation Audits , and identify the gaps...
javalinuxjavascriptproductinnovationemployeeengagementbusinessdevelopmentdesignresearchstrategyramewmodeldesignopeninnovationframewkdesignrectiveactionsroipatentsbusinessalignmentCelebrating its twenty-fifth anniversary in 2016, Cyient is an acknowledged leader in engineering design services, design-led manufacturing, networks and operations, data transformation, and analytics...
autocadtelecommunicationsdocumentationengineeringdesignservicescontinuousimprovementfacilitationpowergenerationelecomnetwkdesignnetwkdesignnetwktopologyJOB DESCRIPTION SUMMARY Candidate should have basic knowledge on Telecom Knowledge on OSP/Fiber planning & design management. Should able to perform fiber planning and design activities using smallwo...
autocadmanufacturingindustrybasictelecomequipmentdesignpowergenerationranspnetwkdesign1. JAVA + SELENIUM AUTOMATION with 3.5yrs and 7yrs for Chennai location. Candidate must have experience in Advance Java knowledge or programming with Selenium, BDD framework design experienced will be...
apitestingadvancedjavaapijavarestdesigntestingseleniumautomationServiceTestAppiumDatabaseTestingDDMSramewkdesignAndroidTestingScalabilityTestingTestrailUIAutomationGUItestautomationAsst Manager project - male Jobs in Guwahati - Vacancy in Sales / Marketing Asst Manager Project - Male Job Description Requires - - - 2 Asst Manager - project for a reputed telecom infrastructur...
pipesalestradingmarketingelecommarketingtelecominfrastructurebushdpesalarysellerssupplierinfrastructureInternetInfrastructureTelecommunicationsConsultingTelecomNetwkDesignTelecomSwitchingTeleRole: Solution Test Engineer - Core, Edge & Datacenter Location: Bangalore The Solution Test Engineer - Solution Test Consultant is a highly technical role, providing post- sales support of Junipe...
testcasesregressiontestingautomationjavaframerelaytestcoveragetinglayer2usecaseipsecvpnusecasesdatacentermusicmakingsalessupptestingtoolsipnetwkingnetwkdesignrobTitle: Advanced Services Engineer 4 Role: Design Validation testing for Financial Services Customer. Location: Bangalore Reporting to the Customer Service Lead, the Design Validation Test Engine...
testcasescustomerservicewebtechnologieswebapplicationsdesignunipernetwksproductslayer2tune100leveldesignpublicsectnetwkdesignsecondaryskillstechnicalsuppproductptfolioRoles and responsibilities Backend Developer: PHP, Laravel, Mysql, Json API development skills.,...
mysqljavascriptcssapihtmlapidevelopmentphpjsonlaravelSDKdevelopmentRESTfularchitectureTwilioTwitterAPIOAuthAPImanufacturingScalableWebApplicationsMicroservicesCodeIgniterZendramewkDesignCARGO , TRANSPORTATION , SURFACE , ROAD OPEARTION , , EXPRESS CARGO . HUB OPERATION Salary (Per Annum) 3 , 00 , 000 6 , 00 , 000 Work Experience 7 Year 12 Year Job Requirements Person having experie...
designdistributionadministrationDWDMFrameRelayetwkdesignbranchoperationpanroadcargopharmasalarycostingageexpresssurfacetransptationQualityofServicederGatewayProtocolCiscoCertifiedStrong Working Experience in RF engineering with dense network design and optimization Knowledge Strong Knowledge on LTE/LTE-A, Virtual RAN Feature, performance, stability, KPI and Mobility Excellen...
debuggingarchitectureestimationcollectionvirtualenvironmentairlinuxrlcpdcpetwkdesignefftestimationPython Developer 4.0 Year(s) To 6.0 Year(s) Python Developer Writing reusable, testable, and efficient code using Python/ Django framework - Design and implementation of low- latency, high- availa...
pythonmysqldjangohtmlcsswebtechnologieswebapplicationsdesignwritingbiddingsecurityjavascriptpdataprotectfrontendserversideframewkdesignprojectadministrationinfnavigationRequired skillset: Minimum 3 years of experience in solution design and undertake architectural framework design. In-depth understanding and solution design using the latest framework, platform, too...
sqlnetiisnetjbossdesignmiddlewaredocumentationsolutiondesigntechnicaldocumentationacledatabasesqldatabaseframewkdesignJob Description Promotion, Sales and distribution of Fully automated Chemilumenesence Instruments and Regents Lumipulse Range in South India. Managing distributors in your sales territory. Meeting th...
salesmarketingtargetretailbusinessdevelopmentdistributionmanagementmanagementvalidationdistributionaccountsModernTradereasalespharmajapaneseterritinstrumentsdistributDistributionNetwkDesignJob Description Promotion, Sales and distribution of Fully automated Chemilumenesence Instruments and Regents Lumipulse Range in South India. Managing distributors in your sales territory. Meeting th...
salesmarketingtargetretailbusinessdevelopmentdistributionmanagementmanagementvalidationdistributionaccountsModernTradereasalespharmajapaneseterritinstrumentsdistributDistributionNetwkDesignGender : Male / Female Industry : IT Skills : Minimum 1+ Year of experience in Testing Build scalable automated test frameworks and test suites working across technologies Participate in design a...
opensourcetestdesigntestplanningteststrategymanualtestingwebapplicationtestautomationsoftwaredevelopmentsqlapiguijavaagilerontendtestsuitesframewkdesignperfmancetestingscr1. A degree in Engineering, IT or Telecommunications, or equivalent 2. Engineer should have at least 5-8 years of experience in RAN domain 3. Minimum 2 years of experience on 4G/LTE RAN domain 4. Exp...
manualtestingengineeringqtpfunctionaltestingmaintenancelanguageenvironmentadministrationtestingltetroubleshootingtelecomsoftwaretestingetwkdesignPreferred Qualification & Experience Requirements: 1. A degree in Engineering, IT or Telecommunications, or equivalent 2. Engineer should have at least 5-8 years of experience in RAN domain3. Minimum ...
administrationtestingphotoshopenvironmentarchitecturearchitectdesignengineeringmaintenancetroubleshootingetwkdesigninteriKey Responsibilities: Person will be responsible all the project related QE activities related to test planning, automation, execution, triaging automation failures, hardening and delivering q...
safetycommissioninginspectiontroubleshootingtestplanningproblemsolvingloudstagebonusprogramsbuildautomationframewkdesigndevelopmentsitesjob description network manager in hyderabad Job Purpose: Installs, configures, supports, and troubleshoots computer networks by performing the following duties. Duties and Responsibilities: - Leadin...
tcpiptuningsecurityetwkdesignadministrationnetwkmonitingMinimum 1+ Year of experience in Testing Build scalable automated test frameworks and test suites working across technologies Participate in design and code inspections Perform manual testing, the ...
testexecutionautomationscriptinglanguagesmailscrumhiringjavaqualityteststrategysoftwaredevelopmenttestplanningestframewkdesign1. A degree in Engineering, IT or Telecommunications, or equivalent 2. Engineer should have at least 5-8 years of experience in RAN domain 3. Minimum 2 years of experience on 4G/LTE RAN domain 4. Exp...
manualtestingengineeringqtpfunctionaltestingmaintenancelanguageenvironmentadministrationtestingltetroubleshootingtelecomsoftwaretestingetwkdesignPreferred Qualification & Experience Requirements: 1. A degree in Engineering, IT or Telecommunications, or equivalent 2. Engineer should have at least 5-8 years of experience in RAN domain3. Minimum ...
administrationtestingphotoshopenvironmentarchitecturearchitectdesignengineeringmaintenancetroubleshootingetwkdesigninteriStrong Working Experience in RF engineering with dense network design and optimization Knowledge Strong Knowledge on LTE/LTE-A, Virtual RAN Feature, performance, stability, KPI and Mobility Excellen...
debuggingarchitectureestimationcollectionvirtualenvironmentairlinuxrlcpdcpetwkdesignefftestimationMinimum 1+ Year of experience in Testing Build scalable automated test frameworks and test suites working across technologies Participate in design and code inspections Perform manual testing, the ...
testexecutionautomationscriptinglanguagesmailscrumhiringjavaqualityteststrategysoftwaredevelopmenttestplanningestframewkdesignjob description network manager in hyderabad Job Purpose: Installs, configures, supports, and troubleshoots computer networks by performing the following duties. Duties and Responsibilities: - Leadin...
tcpiptuningsecurityetwkdesignadministrationnetwkmoniting© 2019 Hireejobs All Rights Reserved