Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Accomplishes marketing objectives Improves product marketability by researching, identifying, and capitalizing on market opportunities; coordinating new product development. Provides information by...
marketing sales businessdevelopment advertising outboundsales salesmanagement digitalmarketing productdevelopment marketinganalytics ustomerrelations newproductdevelopment marketopp tunities relationshipbuiWhat are the key skills we desire of you Marketing Analytics , Analytics Manager , Data Mining , Digital Marketing Wheres our office Green Park , New Delhi Whats the tenure of work experience were exp...
datamining digitalmarketing marketinganalytics academicbackground it brand mining salary metrics running marketing analytics campaigns statistics monit mathematics DigitalStrategy MobileMarketing ng perf manceWhat are the key skills we desire of you Marketing Analytics Analytics Manager Data Mining Digital Marketing Wheres our office Green Park New Delhi Whats the tenure of work experience were expecting f...
contentmanagement editing seo writing websiteproduction datamining digitalmarketing marketinganalytics academicbackground it brand mining salary metrics running marketing analytics campaigns statistics monit ng
Position Analyst and Sr Analyst Relevant experience Qualification Skills Domain Roles and Responsibility 0- 4 yearsB.Tech./ B.E./ Masters Degree/ M.Phil./ MBA from reputed institute(s)Problem S...
marketresearch commercialmodels regressionmodels financialservices businessknowledge predictivemodeling marketinganalytics bpo kpo sas ites spss tfoliomarketing relationanalysis behavi alanalyticsDirector , Marketing Analysis Director , Marketing Analytics Job Type: Permanent Educational Qualification: Graduate , Post Graduate , MBA Experience: 12+ Years of experience in Marketing Preferred Ca...
webtechnologies marketinganalysis marketinganalytics programmingconcepts ci php api zend html5 access twitter analysis facebook features marketing education analytics databases javascript hpframew ksJob Description 1) Selling of cars 2) Revenue generation 3) Sales and marketing activities 4) Customer coordination 5) Looking after the customer satisfaction Automobile sales experienced candid...
sales retail innovative bd upselling creative selling marketing bde eamplayer retailsales productknowledge negotiationskills automobilesales tele-sales marketinganalytics salesrevenue businessdevelopment retailbusinessdevelopment presen
- Provide analytics support to Novartis internal customers (CPOs & Regional marketing and sales teams) on various complex analytical reports.
- Support and facilitate data enabled decision ma...
Associate Domain Consultant - CPG Job ID: ADCPG || Location: Bangalore, India Engage with marketing clients and help them succeed. Manage day-to-day delivery independently along with analyst teams. ...
delivery accounting analytics automation dataanalysis consumergoods teammanagement clientsolutions businessplanning marketingresearch marketinganalytics businessadministration ep ting categ ymanagementJob Description: Cold calling and meeting prospective customers. Prepare plan for acquiring more customers and key accounts. Track customers and prepare timely sales report Achieve Sales Targets for a...
upselling creative innovative sales negotiation lientrelationship excellentcommunicationskills energylevel marketinganalytics marketing teamplayer salesplanning salesrevenue prospectingskills negotiationskills tele-sales presentationskills
Profile Director (FPA)
Job Location Mumabi Hyderabad
Qualification MBA (IIM candidates preffered)
Profile Director (FPA)
Job Location Mumabi Hyderabad
Qualification MBA (IIM candidates preffered)
HIRING FOR TOP INTERNATIONAL CAPTIVE UNIT IN GURGAON LOCATION ! NO AGE BAR ! Excellent communication skills - English (verbal/written). Internal team coordination over email/call. Basic knowledge of...
captive nnovative customerservice sales excellentcommunicationskills presentationskills service marketinganalytics creative teamplayer outboundsales insidesales customer inboundtellecalling presales fieldsalesleadgeneration upselling captHIRING FOR TOP INTERNATIONAL CAPTIVE UNIT IN GURGAON LOCATION ! NO AGE BAR ! Excellent communication skills - English (verbal/written). Internal team coordination over email/call. Basic knowledge of...
captive nnovative customerservice sales excellentcommunicationskills presentationskills service marketinganalytics creative teamplayer outboundsales insidesales customer inboundtellecalling presales fieldsalesleadgeneration upselling captHIRING FOR TOP INTERNATIONAL CAPTIVE UNIT IN GURGAON LOCATION ! NO AGE BAR ! Excellent communication skills - English (verbal/written). Internal team coordination over email/call. Basic knowledge of...
captive nnovative customerservice sales excellentcommunicationskills presentationskills service marketinganalytics creative teamplayer outboundsales insidesales customer inboundtellecalling presales fieldsalesleadgeneration upselling captWant an opportunity to grow with one of the nations premium tech solutions provider company If you are ready to take the next step in your career, join hands with our client for this great opportunit...
digitalagency microsoftexcel brandcampaigns productinnovation digitalconversion affiliatemarketing marketinganalytics communicationskills projectadministration professionalcommunication b2b word step ale KEY RESPONSIBILITIES
Work with marketing clients to help them make smart decisions and then to implement and track them.
o Manage day-to-day delivery independently along with analyst team
HIRING FOR TOP INTERNATIONAL CAPTIVE UNIT IN GURGAON LOCATION ! NO AGE BAR ! Excellent communication skills - English (verbal/written). Internal team coordination over email/call. Basic knowledge of...
captive nnovative customerservice sales excellentcommunicationskills presentationskills service marketinganalytics creative teamplayer outboundsales insidesales customer inboundtellecalling presales fieldsalesleadgeneration upselling captHIRING FOR TOP INTERNATIONAL CAPTIVE UNIT IN GURGAON LOCATION ! NO AGE BAR ! Excellent communication skills - English (verbal/written). Internal team coordination over email/call. Basic knowledge of...
captive nnovative customerservice sales excellentcommunicationskills presentationskills service marketinganalytics creative teamplayer outboundsales insidesales customer inboundtellecalling presales fieldsalesleadgeneration upselling captHIRING FOR TOP INTERNATIONAL CAPTIVE UNIT IN GURGAON LOCATION ! NO AGE BAR ! Excellent communication skills - English (verbal/written). Internal team coordination over email/call. Basic knowledge of...
captive nnovative customerservice sales excellentcommunicationskills presentationskills service marketinganalytics creative teamplayer outboundsales insidesales customer inboundtellecalling presales fieldsalesleadgeneration upselling captRole Summary/Purpose: Seeking intellectually curious candidate with a passion for leading teams & executing and analyzing real world business problems. The AVP, Marketing Analytics will be par...
centerofexcellence b2bmarketing teammanagement projectmanagement datavisualization talentdevelopment thoughtleadership marketinganalytics stakeholdermanagement intellectuallycurious ectiveactionSenior Solution Deployment Strategist(CrossLink Analytics) 2 to 4 yrs Solution Deployment Strategist, CrossLink Analytics , R, SAS, Business and Marketing Analytics, Risk Analytics, SAS Macros, Segmen...
usecases sasmacros dataanalytics riskanalytics productdevelopment marketinganalytics logisticregression statisticalmodeling consultancyservices hr sas roi risk lcommunication behavi altraining edSenior Solution Deployment Strategist(Data Analyst) 2 to 4 yrs Solution Deployment Strategist, Data Analyst, R, SAS, Business and Marketing Analytics, Risk Analytics, SAS Macros, Segmentation, Cluster...
sql dataanalysis microsoftexcel customerrelations usecases sasmacros creditpolicy dataanalytics riskanalytics advancedanalytics productdevelopment marketinganalytics ep ting alcommunication behavDEAR CANDIDATE * Hiring for International Brands with Day Shifts. *Any Graduate Fresher Or Undergrad with Minimum 6months of International Experience can apply. *Sal.Pkg 12k to 27k Plus Incentives *L...
telesales telemarketing oicesupport sales excellentcommunicationskills presentationskills salesrevenue marketinganalytics teamplayer outboundsales insidesales customer inboundtellecalling inbound presales fieldsalesleadgeneration salesbdDirector , Marketing Analysis Director , Marketing Analytics Job Type: Permanent Educational Qualification: Graduate , Post Graduate , MBA Experience: 12+ Years of experience in Marketing Preferred Ca...
webtechnologiesmarketinganalysismarketinganalyticsprogrammingconceptsphpapizendhtml5accesstwitteranalysisfacebookfeaturesmarketingeducationanalyticsdatabasesjavascripthpframew" Identify opportunities, produce leads and book appointments for the sales force with the emphasis on high quality leads. Develop creative pitches and propositions aimed at specific industry sectors...
telemarketing upselling telesales telecalling sales marketing rossselling excellentcommunicationskills upselling outboundsales presales salesrevenue negotiationskills outboundcalling tele-sales salesbd marketinganalytics inboundtellecalliDear Candidate, Greetings from Elite Estate, We are hiring for Marketing Executive / Tele caller.Candidate needs to carry 1 copies of your resume along with an ID or Address Proof. Job Responsibilit...
upsellinginnovativecreativeitemeetingsalesrevenuemarketinganalyticstele-salesnegotiationskillsbusinessdevelopmentinboundtellecallingexcellentcommunicationskillsclientrelationshipgenerateleadoutboundsaleswebsalesproductknowledgepresentationi. Part of the growing team of DAC with an opportunity to grow with the team. Opportunity to learn both the aspects of Risk and Marketing analytics and get a holistic view of a business. ii. Campaign...
dataanalyticsmarketinganalyticsmisdacrisksourcingmarketinganalyticsealthcheckcampaignanalyticsregulatyreptingroidrawclusterbusinessreptingcampaignsregulatregressionSecurityPatchManagemIf you are confident of fulfilling an extremely critical function of a rapidly growing business, and want to work in a culture that supports a great degree of flexibility and freedom, then here is a r...
deliveryprojectmanagementjavaadvancedexcelmarketresearchproblemsolvingclientservicingclientengagementmarketinganalyticsustomerrelationsreptingfareastflowchartsdatamodelssystemsetupclientonboardingcustomHello job seekers, Urgent hiring of Customer Care Executive (Chat/Voice/Email) for Mohali location. Requirements : 1. Good communication skills 2. Min qualification 12th 3. Male and Female both c...
telesalesresalesinternationalvoiceexcellentcommunicationskillspresentationskillsinternationalcallcenteroutboundsalessalesclientrelationshipfresherwebsalesupsellingmarketinganalyticstele-salesnegotiationskillsfieldsalesleadgenerationsalesbdAbout 2- 5 years of experience in Digital Media Sales, Digital Agency or Brand side. Have worked on Digital Marketing planning, Strategy or sales extensively. Out of the box thinker. Creative on...
mediasalesdigitalmediamediaplanningmobilemarketingdigitalmarketingaccountmanagementmarketinganalyticscommunicationskillssalesmobilesearchstrategyigitalagencymarketingplanningbrandagencyHIRING FOR TOP INTERNATIONAL CAPTIVE UNIT IN GURGAON LOCATION ! NO AGE BAR ! Excellent communication skills - English (verbal/written). Internal team coordination over email/call. Basic knowledge of...
captivennovativecustomerservicesalesexcellentcommunicationskillspresentationskillsservicemarketinganalyticscreativeteamplayeroutboundsalesinsidesalescustomerinboundtellecallingpresalesfieldsalesleadgenerationupsellingcaptiveunitsalesbdHIRING FOR TOP INTERNATIONAL CAPTIVE UNIT IN GURGAON LOCATION ! NO AGE BAR ! Excellent communication skills - English (verbal/written). Internal team coordination over email/call. Basic knowledge of...
captivennovativecustomerservicesalesexcellentcommunicationskillspresentationskillsservicemarketinganalyticscreativeteamplayeroutboundsalesinsidesalescustomerinboundtellecallingpresalesfieldsalesleadgenerationupsellingcaptiveunitsalesbdDear Candidate, We are Looking for Call Center Executive. Job Description Managing large amounts of Inbound and Outbound calls in a timely manner. Identify Customers needs and delivering Voice Ser...
qualityexcelustomersatisfactionfirstcallresolutionsmsofficequalityservicemarketinganalyticsexcellentcommunicationskillspresentationskillsclientrelationshiptele-salesDelivering reports, dashboards and presentations in the patient analytics, sales analytics, prescription data and channel dynamics space Synthesize data into actionable data insights, strategies, and...
sqljavacustomerrelationssapdocumentationprojectlifecycledeliveryofprojectslifecyclesalesanalyticsprocessimprovementmarketinganalyticssalesdesigntacticsupstreamtatementsofwksowdynamiGreetings from SMART HR CONSULTANCY we have urgent requirement for BDM_AC in MNC life insurance job description:- .Responsible for recruiting and managing a team of leader and agents .responsible ...
upsellinginsurancesalesmarketingegotiationskillspresentationskillsmarketinganalyticsmarketingmanagementclientrelationshipbusinessdevelopmentcorporatesalestele-salesexcellentcommunicationskillslifeinsuranceproductknowledgeDEAR CANDIDATE * Hiring for International Brands with Day Shifts. *Any Graduate Fresher Or Undergrad with Minimum 6months of International Experience can apply. *Sal.Pkg 12k to 27k Plus Incentives *L...
telesalestelemarketingoicesupportsalesexcellentcommunicationskillspresentationskillssalesrevenuemarketinganalyticsteamplayeroutboundsalesinsidesalescustomerinboundtellecallinginboundpresalesfieldsalesleadgenerationsalesbdcustomerserviceskGreetings from SMART HR CONSULTANCY we have urgent requirement for BDM_AC in MNC life insurance job description:- .Responsible for recruiting and managing a team of leader and agents .responsible ...
marketingupsellingsalesinsuranceorporatesalesmarketinganalyticslifeinsuranceproductknowledgenegotiationskillsclientrelationshippresentationskillssalesrevenuemarketingmanagementexcellentcommunicationskillstele-salesbusinessdevelopmentGreetings from SMART HR CONSULTANCY we have urgent requirement for BDM_AC in MNC life insurance job description:- .Responsible for recruiting and managing a team of leader and agents .responsible ...
marketingupsellingsalesinsuranceorporatesalesmarketinganalyticslifeinsuranceproductknowledgenegotiationskillsclientrelationshippresentationskillssalesrevenuemarketingmanagementexcellentcommunicationskillstele-salesbusinessdevelopmentGreetings from SMART HR CONSULTANCY we have urgent requirement for BDM_AC in MNC life insurance job description:- .Responsible for recruiting and managing a team of leader and agents .responsible ...
upsellinginsurancesalesmarketingegotiationskillspresentationskillsmarketinganalyticsmarketingmanagementclientrelationshipbusinessdevelopmentcorporatesalestele-salesexcellentcommunicationskillslifeinsuranceproductknowledgePosition Analyst and Sr Analyst Relevant experience Qualification Skills Domain Roles and Responsibility 0- 4 yearsB.Tech./ B.E./ Masters Degree/ M.Phil./ MBA from reputed institute(s)Problem S...
marketresearchcommercialmodelsregressionmodelsfinancialservicesbusinessknowledgepredictivemodelingmarketinganalyticsbpokposasitesspsstfoliomarketingrelationanalysisbehavialanalyticsi. Part of the growing team of DAC with an opportunity to grow with the team. Opportunity to learn both the aspects of Risk and Marketing analytics and get a holistic view of a business. ii. Campaign...
dataanalyticsmarketinganalyticsmisdacrisksourcingmarketinganalyticsealthcheckcampaignanalyticsregulatyreptingroidrawclusterbusinessreptingcampaignsregulatregressionSecurityPatchManagemDear Candidate, Greetings from Elite Estate, We are hiring for Marketing Executive / Tele caller.Candidate needs to carry 1 copies of your resume along with an ID or Address Proof. Job Responsibilit...
upsellinginnovativecreativeegotiationskillsmarketinganalyticsclientrelationshipsitemeetingbusinessdevelopmentsalesrevenuepresentationskillstele-salesoutboundsalesinboundtellecallingproductknowledgeexcellentcommunicationskillsgenerateleadA business development professional has three primary responsibilities: Identifying new sales leads Pitching products and/or services Maintaining fruitful relationships with existing customers When i...
telesalesigitalmarketingclientrelationshipoutboundsalesinboundtellecallingmarketinganalyticsexcellentcommunicationskillsfieldsalesleadgenerationpresentationskillsinsidesalesattendingconferences
Have worked on Digital Marketing planning, Strategy or sales extensively. Out of the box thinker. Creative on Digital media ideas for brands to convert into business. Hands on with Digital Media pl...
digitalmediamediaplanningwebtechnologiesmobilemarketingdigitalmarketingaccountmanagementmarketinganalyticscommunicationskillssalesmobilesearchstrategymarketingarketingplanningbusinessplanningAbout 2- 5 years of experience in Digital Media Sales, Digital Agency or Brand side. Have worked on Digital Marketing planning, Strategy or sales extensively. Out of the box thinker. Creative on...
mediasalesdigitalmediamediaplanningmobilemarketingdigitalmarketingaccountmanagementmarketinganalyticscommunicationskillssalesmobilesearchstrategyigitalagencymarketingplanningbrandagencyAbout 2-5 years of experience in Digital Media Sales, Digital Agency or Brand side. Have worked on Digital Marketing planning, Strategy or sales extensively. Out of the box thinker. Creative on ...
mediasalesdigitalmediamediaplanningmobilemarketingdigitalmarketingaccountmanagementmarketinganalyticscommunicationskillssalesmobilealesaccountdigitalagencymarketingplanningbrandagencyseaSkills Problem Solving Business Skills SAS, SPSS Predictive Modeling Statistical Forecasting Models Behavioral Analytics Marketing Analytics Correlation & Regression Models Strong communication skills...
marketresearchproblemsolvingfinancialservicesmarketinganalyticscommunicationskillstrongcommunicationskillscommercialmodelsregressionmodelsbusinessknowledgepredictivemodelingtfoliomarketingPosition Analyst and Sr Analyst Relevant experience 0- 4 years Qualification B.Tech./ B.E./ Masters Degree/ M.Phil./ MBA from reputed institute(s) Skills Problem Solving Business Skills SAS, SPSS Pred...
marketresearchproblemsolvingfinancialservicesmarketinganalyticscommunicationskillstrongcommunicationskillscommercialmodelsregressionmodelsbusinessknowledgepredictivemodelingtfoliomarketing© 2019 Hireejobs All Rights Reserved