Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Seamless communication with agents I customers on a day to day basis with regard to shipments. Mails should be ackledged immediately on receipt of the same and reply within time zone and there should ...
fareast salesleads keyaccounts newbusiness shippingline customerservice it caf sop far sales cargo quote prompt customs sailing shipping business shippers endSeamless communication with agents I customers on a day to day basis with regard to shipments. Mails should be ackledged immediately on receipt of the same and reply within time zone and there should ...
fareast salesleads keyaccounts newbusiness shippingline customerservice it caf sop far sales cargo quote prompt customs sailing shipping business shippers end02-May-2019 Manager - Data Privacy 144327BR Job Description Roles and Responsibilities justify;line-height: 115%;text-autospace: none > Business Development 6.0pt;margin-left: 35.0pt;text-...
sales risk ansi ema design raud it pii symbol brand trust mso height latinSkill Set: Candidate must have good understanding of KYC. Good knowledge of capital markets and Regulatory Requirements would be added advantage. = Able to understand the E2E KYC requirements for d...
capital marketsanalytical skills financial servicesinterpersonal skills regulatory requirementskyc businesssanctionRoles and Responsibilities Project Related 9. 0pt;font- family: Symbol;mso- fareast- font- family: Symbol;mso- bidi- font- family: Symbol Understand / Capture Business, process & project requ...
sales mis accounts tat banking itaudit processdesign problemsolving riskconsulting ubjectmatterexpertise continuousimprovementfacilitation usecases itadvis erpsoftware salessupp financialsect26 - Mar - 2019 Ariba Manager 143336BR Job Description Good communication Spoken / written; Should be able to manage a small team. Should be able to work on business development and pre - sal...
erp ar ansi ariba ema color presales training sales ar golive it mso latin businessRoles & Responsibilities mso- fareast- font- family:Symbol;mso- bidi- font- family:Symbol;color:black mso- bidi- font- size:11.0pt;font- family: Tahoma , sans- serif;color:black Translate busines...
machinelearning python dataanalysis sql analytics datamining opensource publicpolicy textanalytics riskmanagement dataextraction computerscience financialservices assql teamskills commercialmodels associationrules busiIntroduction TBD Your Role and Responsibilities About IBM: IBM is a global technology and innovation company. It is the largest technology and consulting em...
lient Technical Specialist04 - Jul - 2019 KGS MC ACon/ Con/ AM Appian 145756BR Job Description text - indent: - . 25in;mso - list: l0 level1 lfo1 > Symbol > Hands on experience on BPMS implementations process d...
agilexsdj2eebpmesbpegawaterfalllogjruleswebservicessqlserver26 - Mar - 2019 Ariba Manager 143336BR Job Description Good communication Spoken / written; Should be able to manage a small team. Should be able to work on business development and pre - sal...
erpansiaribaemacolorpresalestrainingsalesgolivemsolatinbusiness21 - Aug - Assistant Manager - .Net 3.5 , 4.0 137144BR Job Description normal >Position: Assistant Manager normal >Business: Technology normal >Location: Noida normal > Job Summary: te...
etlwcfrisknetsqlaspdhtmlcsslinqtaxmso03- Jul- 2019 Google Cloud Architect 145787BR Job Description justify;line- height:normal > mso- bidi- theme- font:minor- latin;color:#333333;mso- fareast- language:EN- GB >Roles and Respon...
linuxtroubleshootingunixewbusinessgooglecloudplatformemergingtechnologiesbusinesscaseinfluenceothersadobestreamlinecostbenefitanalysispresentationskillscostbenefitenterprisesystemsIf you are confident of fulfilling an extremely critical function of a rapidly growing business, and want to work in a culture that supports a great degree of flexibility and freedom, then here is a r...
deliveryprojectmanagementjavaadvancedexcelmarketresearchproblemsolvingclientservicingclientengagementmarketinganalyticsustomerrelationsreptingfareastflowchartsdatamodelssystemsetupclientonboardingcustomAs a Talent Acquisition Manager , your responsibility will be to understand the talent needs of the organization, and liaising with various departments of the company. What you will do:
Here is an opportunity to play a key role and have a fantastic career filled with learning and growth inthe leading market research and analytics company! Our client is a Marketing and Analytics comp...
projectmanagementautomationcostcontroldeliveryltdmarketresearchclientservicingclientengagementoingtheextramilefareastnewbusinessexcelmodelsclientaccountsmanagingaccountsaccountmanagemeHere is an opportunity to play a key role and have a fantastic career filled with learning and growth in the leading market research and analytics company! Our client is a Marketing and Analytics com...
projectmanagementautomationcostcontroldeliveryltdmarketresearchpublicrelationssalesoperationscustomerexperiencebusinessdevelopmentusinessdevelopmentoperationsfareastrelationmanagementcustomer16 - Jul - Executive - Risk Management 146098BR Job Description minor - latin;mso - hansi - font - family:Calibri;mso - hansi - theme - font:minor - latin; mso - bidi - font - family:Calibri;mso...
problemsolvingapprovalprocesscommunicationskillsprofessionalservicesclientserviceemamsotaxriskrubyroadlatinagendafinancetradingbusinesssentineleducationirpThe Associate 1 will bepredominantly responsible for: Develop skillsets to process large data extracts fromclient ERP systems into the KPMG D&A proprietary tool Develop understanding ofKPMGs servi...
sqlmsbisaptaxashsparkAssociate - CA 136627BR Job Description Roles and Responsibilities mso - fareast - font - family:Symbol;mso - bidi - font - family:Symbol;mso - ansi - language: EN - US font - family: Univers ...
strategyfilingansiauditingtaxationtaxusinessreturnssurfacerecordssymbolbrandmsocapitalrefundsRoles & Responsibilities mso- fareast- font- family:Symbol;mso- bidi- font- family:Symbol;color:black mso- bidi- font- size:11.0pt;font- family: Tahoma , sans- serif;color:black Translate busines...
machinelearningpythondataanalysissqlanalyticsdataminingopensourcepublicpolicytextanalyticsriskmanagementdataextractioncomputersciencefinancialservicesassqlteamskillscommercialmodelsassociationrulesbusiIsolate issues using trace route, path ping, nslookup b. Logon to remote server using terminal server (RDP / telnet / putty), for parameter / health checks. a. Check logs and services (such...
ssosop rdpmso pingansi fsmocloudmso - bidi - font - family: Times New Roman ;color:black Logon to remote server using terminal server (RDP / telnet / putty), for parameter / health checks. color:black a. mso - bidi - font - f...
ssosoprdpansicloudfsmoemailputtystepscol09 - Oct - 2018 Associate Director - Commercial Due Diligence (FMCG Sector) 138440BR Job Description Job Title : Associate Director Function : Transaction Service Commercial Due diligence , De...
itesasciiriskansisalesatinmsofoodexcelmso - hansi - font - family : Calibri;mso - bidi - font - family : Times New Roman ; color : black Roles & Responsibilities mso - hansi - font - family : Calibri;mso - bidi - font - family : Tim...
certifiedtipstrainerenterprisemanagementtoolscustomerservicelogshippingsqlscriptingdatamanagementriskassessmentcustomerservicetechnicalskillsdatabaseservershighavailabilityreleaseentationmso - bidi - font - family: Times New Roman ;color:black Manage alerts for new / existing servers with a basic knowledge on the working technology color:black OS & Networking color:black a. Mo...
access gatewaytechnical skills interpersonal skills xenmso ansibasicmso - bidi - font - family: Times New Roman ;color:black Manage alerts for new / existing servers with a basic knowledge on the working technology color:black OS & Networking color:black a. Mo...
xenansibasicvmwarecitrixxenappmsoemailcolaccessmso-bidi-font-family: Times New Roman ;color: black Isolate issues using trace route, path ping, nslookup b. mso-bidi-font-family: Times New Roman ;color: black Logon to remote server usi...
ssosoprdpansicloudpingfsmoemailputtysteps02-May-2019 Manager - Data Privacy 144327BR Job Description Roles and Responsibilities justify;line-height: 115%;text-autospace: none > Business Development 6.0pt;margin-left: 35.0pt;text-...
salesriskansiemadesignraudpiisymbolbrandtrustmsoheightlatin26 - Mar - 2019 Ariba Manager 143336BR Job Description Good communication Spoken / written; Should be able to manage a small team. Should be able to work on business development and pre - sal...
erpansiaribaemacolorpresalestrainingsalesgolivemsolatinbusiness21 - Aug - Assistant Manager - .Net 3.5 , 4.0 137144BR Job Description normal >Position: Assistant Manager normal >Business: Technology normal >Location: Noida normal > Job Summary: te...
etlwcfrisknetsqlaspdhtmlcsslinqtaxmso03- Jul- 2019 Google Cloud Architect 145787BR Job Description justify;line- height:normal > mso- bidi- theme- font:minor- latin;color:#333333;mso- fareast- language:EN- GB >Roles and Respon...
linuxtroubleshootingunixewbusinessgooglecloudplatformemergingtechnologiesbusinesscaseinfluenceothersadobestreamlinecostbenefitanalysispresentationskillscostbenefitenterprisesystemsAbout the position The Associate 2 will beworking in Audit Data & Analytics (D&A) domain and develop expertise indesigning and developing D&A solutions using tools such as Interactive DataExtraction...
risktaxsapsqlparkcashHere is an opportunity to play a key role and have a fantastic career filled with learning and growth inthe leading market research and analytics company! Our client is a Marketing and Analytics comp...
projectmanagementautomationcostcontroldeliveryltdmarketresearchclientservicingclientengagementoingtheextramilefareastnewbusinessexcelmodelsclientaccountsmanagingaccountsaccountmanagemeHere is an opportunity to play a key role and have a fantastic career filled with learning and growth in the leading market research and analytics company! Our client is a Marketing and Analytics com...
projectmanagementautomationcostcontroldeliveryltdmarketresearchpublicrelationssalesoperationscustomerexperiencebusinessdevelopmentusinessdevelopmentoperationsfareastrelationmanagementcustomer: Knowledge on Server Hardware - Multiple Vendors, Remote Management Tools, Software & Hardware Raid, Clear network fundamentals & topology mso- fareast- font- family: Times New Roman Business ...
raidsoftwarestrategymanagementservicedeliverydeliverymanagementcostingvendhardwarebusinessnetwkingnewbusinessfundamentalshardwarenetwkingmso - bidi - font - family: Times New Roman ;color:black Logon to remote server using terminal server (RDP / telnet / putty), for parameter / health checks. color:black a. mso - bidi - font - f...
ssosoprdpansicloudfsmoemailputtystepscol09 - Oct - 2018 Associate Director - Commercial Due Diligence (FMCG Sector) 138440BR Job Description Job Title : Associate Director Function : Transaction Service Commercial Due diligence , De...
itesasciiriskansisalesatinmsofoodexcelManage alerts for new/existing servers with a basic knowledge on the working technology OS & Networking a. Monitor Server hardware & escalate issues to the right resolver groups XenApp Server ...
xenansibasicvmwarecitrixxenappdesktopmsoemailaccessCalibri;mso- fareast- theme- font:minor- latin;mso- bidi- font- family:Calibri; color:#666666;mso- ansi- language:EN- US;mso- fareast- language:EN- US;mso- bidi- language: AR- SA"> The Intera...
ANSI Product management Interaction design Visual Design Usability testing Skill development Research Web technologiesJob Description About IBM
Job Description About IBM
© 2019 Hireejobs All Rights Reserved