organizing applicant information jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

organizing applicant information Job Openings

Showing 23101 - 23150 of 37577 Jobs

Program Manager-IT

T AND M SERVICES CONSULTING PVTLTD 7.00 to 12.00 Years Chennai 29 Oct, 2024

Roles and Responsibilities

serviceenterpriseweb servicesdata warehousingapi

Hr Generalist

MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 5.00 to 9.00 Years Chennai,Bangalore, Noida, Hyderabad, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

Responsibilities

Administer compensation and benefit plans

Assist in talent acquisition and recruitment processes

Conduct employee onboarding and help organize t...
inductionhr coordinationemployee orientationhr assistanceattendance managementemployee engagementjoining formalitieshr generalist

Office Assistant

LEADZN PRIVATE LIMITED 6.00 to 11.00 Years Chennai,Bangalore, Noida, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City, Delhi 29 Oct, 2024

What does an office assistant do

front office management

Safety Supervisor FMCG Company

RUCHI FOOD PROCESSING 1.00 to 2.00 Years Chennai,Bilaspur, Bangalore, Hyderabad, Kolkata, Pune, Mumbai City, Bhillai, Korba, Raigarh 29 Oct, 2024

Job Title:Safety Supervisor

Company: FMCG Company

Location:In your state

Job Type:Full-Time

Salary 22,500 to 55,5...
safety auditsafety inspectionsafetysafety officer activitiessafety trainingwork permit systemcommunication safetysafety officersafety managrment

Administrator
OVERNET TRADING PRIVATE LIMITED 19.00 to 25.00 Years Chennai,Tambaram, Kanchipuram, Kodaikanal, Vilupuram, Nagapattinam, Sivagangai, Theni, Namakkal, Kum 29 Oct, 2024

We are looking for a sharp administrator to provide leadership support and keep the office running smoothly and efficiently. In this role, you will be required to oversee administrative and cleri...
administratorassistant production managersite supervisorproject managerfacility managermining engineervice president of administrationsenior quality engineerhse specialist

Territory Officer
KINAL GLOBAL CARE PRIVATE LIMITED 4.00 to 9.00 Years Chennai,Chakan, Romania, Zimbabwe, Panaji, Saudi Arabia, Bhubaneswar, Rwanda, Uganda, Tanzania, Bang 29 Oct, 2024

You will be responsible for the promotion of the new product. You will be executing the Product Management Team s marketing strategy, analysing market trends, consulting with doctors on ...
analytical skillsconsultingfinancial forecastingproduct planningauditing standardsmarketing strategymonitoring toolscommunication skillsterritory management

Hospitality Manager
AES INDUSTRIAL PRIVATE LIMITED 9.00 to 14.00 Years Chennai,Botswana, Bangladesh, Qatar, South Africa, South Korea, Bangalore, Ernakulam, Idukki, North 29 Oct, 2024

A Hospitality Manager is a professional responsible for organizing and overseeing the daily operations of facilities in the hospitality industry. They hire qualified personnel, coordinate operati...
hotel asset managementhospital administrationchefhotel operationsprofit managerhealthcare industryhotel accountshospital managementpatient safety

BPM Consultant
CONSULTTRINITY SERVICES PRIVATE LIMITED 3.00 to 8.00 Years Chennai,Hyderabad 29 Oct, 2024

Job Title: Camunda BPM Developer Location:Chennai & Hyderabad Experience: 4 Years Work Mode:Hybrid Job Type: springmicroservicesbpmmodelerboot

Lease Administrator
GALLAGHER AND MOHAN PRIVATE LIMITED 4.00 to 9.00 Years Chennai,Bangalore, Noida, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi, Port Blair 29 Oct, 2024

Lease Administrator
What we are and what we do:- Gallagher & Mohan works exclusively within the real estate industry. Our mission is to provide financial analysis, mark...
lease administrationadministration

Key Account Manager
Sigma Allied Services Private Limited 2.00 to 7.00 Years Chennai 29 Oct, 2024

Greetings from Sigma! I am a Staffing Specialist at Sigma Allied Services Pvt Ltd. I am reaching out to you on an exciting job opportunity with one of our clients. Job Title : KAM (Key Account ...
retail salesfield sales

Biomedical Technician
LEADZN PRIVATE LIMITED 10.00 to 20.00 Years Chennai,Zimbabwe, Mozambique, Bangalore, Noida, United Arab Emirates, Hyderabad, Kolkata, Gurugram, 29 Oct, 2024

We are looking for a dynamic biomedical technician to join our biomedical department. In this role, youll be in charge of overseeing the care and use of all biomedical equipment, performing machi...
biomedical engineeringhealthcarehealthcare operationsmedical equipment planningclinical engineeringcardiologybiomedicaltechnical processbiomedical electronicsnutritionistanalyst

Housekeeping Supervisor
NEW ERA LIFE CARE PRIVATE LIMITED 19.00 to 22.00 Years Chennai,Bangalore, Noida, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi, Port Blair 29 Oct, 2024

We are looking for a Housekeeping Supervisor to lead our team of room attendants and ensure we provide excellent customer service. Housekeeping Supervisor responsibilities include organizing emp...
oshacustomer servicefront deskguest satisfactionclean roomssafety hazardscleanlinessroom attendantsguest rooms

Java Architect
UST Global 12.00 to 22.00 Years Chennai,Kochi, Thiruvananthapuram 29 Oct, 2024

Java Architect Location: Chennai, Trivandrum,Kochi Notice: Immediate-30 Days We are seeking a highly experienced Java Architect with a proven track record in delivering large-s...
solution architecturejavasolution design

Medical Coding for Nutrition and Dietitian Wanted -CT Priya
Alpha Medical Coding Solutions 0.00 to 2.00 Years Chennai,Vellore, Thanjavur, Madurai, Salem, Thoothukudi, Tiruchirappalli, Coimbatore, Bangalore, Hyd 29 Oct, 2024

Medical Coding Job HR Gokulapriya hr hidden_mobile( Whatsapp ur resume) Position: Medical Coder Medical Coding...
physiotherapymedical codingnursingbiochemistrybptmptzoologypharmacybiomedical

medical coder for B.E B.Tech Biomedical biotechnology Bioinformatics- CT Jp
Alpha Medical Coding Solutions 0.00 to 2.00 Years Chennai,Vellore, Thanjavur, Madurai, Salem, Thoothukudi, Tiruchirappalli, Coimbatore, Bangalore, Hyd 29 Oct, 2024

Medical Coding Job CT HR JayaPriya-hidden_mobile(Whatsapp ) Position: Medical Coder medical codingbiochemistrypharmacybiomedicalmptbiotechnologyzoologynursingphysiotherapy

Hr Recruiter
ARYAN TECHNOLOGY 1.00 to 6.00 Years Chennai,Bangalore, Noida, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City, Delhi 29 Oct, 2024

HR Officer Responsibilities:

Preparing job descriptions, advertising vacant positions, and managing the employment process.

Orientatin...
hr operationshr analyticspayroll

Event Planner
AES INDUSTRIAL PRIVATE LIMITED 7.00 to 12.00 Years Bangalore,Other Assam, Chennai, Other Andhra Pradesh, Gurugram, Pune, Delhi, Other Haryana, Other Bi 29 Oct, 2024

We are looking for a successful and enthusiastic Event Planner to produce events from conception through to completion. Event Coordinator responsibilities include providing outstanding customer s...
managementplanningtimeeventskillsdetail

Medical Coder - Biomedical, Biotech, Bio-Chem Grad- CT Priya
Alpha Medical Coding Solutions 0.00 to 2.00 Years Bangalore,Salem, Vellore, Thanjavur, Madurai, Chennai, Thoothukudi, Hyderabad, Tiruchirappalli, Coim 29 Oct, 2024

Medical Coding Job CT HR Gokulapriya-hidden_mobile(Whatsapp ) Position: Medical Coder zoologymedical codingbptpharmacynursingbiochemistryphysiotherapymptbiotechnology

Business Consultant
M/S AASTHA LIFECARE CORPORATION PRIVATE LIMITED 15.00 to 24.00 Years Bangalore,Mangalore, Anantnag, Latehar, Sheopur, Hyderabad, Kolkata, Gurugram, Ujjain, Pathanamthitt 29 Oct, 2024

We are looking for a qualified and motivated business consultant to assess and reform business operations, provide expert guidance, and implement projects. The business consultants responsibiliti...
analysisstrategyconsultingplanningbusinessdevelopmentmanagementmarketingstrategic

Assistant Manager
AES INDUSTRIAL PRIVATE LIMITED 5.00 to 10.00 Years Bangalore,China, Bangladesh, Qatar, South Africa, Port Blair, South Korea, Iraq, Sri Lanka, Chennai, 29 Oct, 2024

We are looking for a responsible Assistant Manager to help organize and run our retail stores and fill in for thewhen needed. Your job will be highly important in ensuring the sales team meets it...
assistant workmanager self-service

Business Development
Ginger Media Group 2.00 to 7.00 Years Bangalore 29 Oct, 2024

Job Title: Business Development Manager (Sales) Role Definition: Business Development (Sales) Manager would be primarily responsible to attracting new business clients through different sales c...
b2b marketingb2b salesbusiness development

Office Assistant
LEADZN PRIVATE LIMITED 6.00 to 11.00 Years Bangalore,Chennai, Noida, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City, Delhi 29 Oct, 2024

We are looking for a competent Office Assistant to help with the organization and running of the daily administrative operations of the company.
What does an office assistant do
The i...
yield managementschedulingoperationsfrontofficesales coordinationfront office managementsalesdevelopmentbusinessmanagersupervisorproposalaccount

Territory Officer
KINAL GLOBAL CARE PRIVATE LIMITED 4.00 to 9.00 Years Bangalore,Chakan, Romania, Zimbabwe, Panaji, Saudi Arabia, Bhubaneswar, Rwanda, Uganda, Tanzania, Ph 29 Oct, 2024

You will be responsible for the promotion of the new product. You will be executing the Product Management Team s marketing strategy, analysing market trends, consulting with doctors on ...
analytical skillsconsultingfinancial forecastingproduct planningauditing standardsmarketing strategymonitoring toolscommunication skillsterritory management

Hospitality Manager
AES INDUSTRIAL PRIVATE LIMITED 9.00 to 14.00 Years Bangalore,Botswana, Bangladesh, Qatar, South Africa, South Korea, Ernakulam, Chennai, Idukki, North 29 Oct, 2024

A Hospitality Manager is a professional responsible for organizing and overseeing the daily operations of facilities in the hospitality industry. They hire qualified personnel, coordinate operati...
hotel asset managementhospital administrationchefhotel operationsprofit managerhealthcare industryhotel accountshospital managementpatient safety

Lease Administrator
GALLAGHER AND MOHAN PRIVATE LIMITED 4.00 to 9.00 Years Bangalore,Noida, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi, Port Blair 29 Oct, 2024

Lease Administrator
What we are and what we do:- Gallagher & Mohan works exclusively within the real estate industry. Our mission is to provide financial analysis, mark...
lease administrationadministration

Business Development Executive
MEDI TRANSCARE PRIVATE LIMITED 1.00 to 6.00 Years Bangalore 29 Oct, 2024

HI, We have a vacancy for leading MNC medical devices company on Medi Transcare employent. Designation: BDE Location: Bangalore/ Bengaluru JOB Description

Mee...
sellingsalescommunicationpharmadevices

Hr Generalist
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 5.00 to 9.00 Years Bangalore,Noida, Chennai, Hyderabad, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

Responsibilities

Administer compensation and benefit plans

Assist in talent acquisition and recruitment processes

Conduct employee onboarding and help organize t...
inductionhr coordinationemployee orientationhr assistanceattendance managementemployee engagementjoining formalitieshr generalist

Clinical Assistant
NEW ERA LIFE CARE PRIVATE LIMITED 3.00 to 8.00 Years Bangalore,Noida, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi, Anantpur 29 Oct, 2024

We are looking for a Clinical Assistant to join our team to help create a positive experience for our patients whenever they visit our facility. Clinical Assistant responsibilities include welco...
entrycustomercompassionsurgicalprocedureshipaabloodpressuredataservicecarepatientcallsphoneexamdirect

Bpo Executive
IZEE MANPOWER CONSULTANCY PVT LTD 0.00 to 4.00 Years Bangalore 29 Oct, 2024

Dear THIS IS JANVI FROM IZEE MANPOWER I hope this message finds you well. We are excited to announce an excellent career opportunitys , in leading (MNC) COMPANIES for (BPO). We are currently se...
international call centerinternational voice

Child Life Specialist
NEW ERA LIFE CARE PRIVATE LIMITED 11.00 to 21.00 Years Bangalore,Chennai, Noida, Nellore, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City, Delhi 29 Oct, 2024

We are looking for a Child Life Specialist to join our team and help our pediatric patients have a more relaxing and effective recovery time while in our healthcare facility. Child Life Speciali...
collaborationleadershipcommunicationadvocacytherapydevelopmentpatienceemotionalservicesfamilylifeempathychildplayengaging

Reservation Associate
JAI AMBEY EMERGENCY SERVICES (I) PRIVATE LIMITED 2.00 to 7.00 Years Bangalore,Churu, Cuttack, Anjaw, Tinsukia, Ghaziabad, Other Andhra Pradesh, Yamunanagar, Kavaratti, 29 Oct, 2024

ob description Process all reservation requests, changes, and cancellations received by phone, fax, or mail. Identify guest reservation needs and determine appropriate room type. Verify availabi...
hotel managementcustomer supporthotel bookingcommunication skillshotel operationshospitality managementhotel administration

Biomedical Technician
LEADZN PRIVATE LIMITED 10.00 to 20.00 Years Bangalore,Zimbabwe, Mozambique, Noida, Chennai, United Arab Emirates, Hyderabad, Kolkata, Gurugram, 29 Oct, 2024

We are looking for a dynamic biomedical technician to join our biomedical department. In this role, youll be in charge of overseeing the care and use of all biomedical equipment, performing machi...
biomedical engineeringhealthcarehealthcare operationsmedical equipment planningclinical engineeringcardiologybiomedicaltechnical processbiomedical electronicsnutritionistanalyst

AthenaOne Systems Analyst Role (Pan India)
Wroots Global Private Limited 7.00 to 12.00 Years Bangalore,Chennai, Noida, Ghaziabad, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

We are currently looking for anAthenaOne Systems Analystto join our team in (Pan India). This role involves supporting, configuring, and troubleshooting the AthenaOne EMR system,...
emrathenacollectorclinicals

Travel Desk Executive
Panamax Infotech 3.00 to 7.00 Years Ahmedabad,Other Gujarat 29 Oct, 2024

Location : Ahmedabad Experience : 3 to 6 Years No. Of Positions : 3 Qualifications : Any Graduate Job Description 6 Days working 24/7 rotational shifts Booking Travel Arrangements: This invo...
CoordinationCustomer ServiceExpense ManagementDocumentationBooking Travel ArrangementsItinerary PlanningTravel Policy Compliance

Cyber Security Trainer/ IT Trainer
TechDefence 3.00 to 7.00 Years Ahmedabad,Other Gujarat 29 Oct, 2024

Company Description TechDefence is an innovative and visionary IT security company based in Ahmedabad. We specialize in technical threat management, cyber security consulting, SOC service, and do...
Application SecurityNetwork SecurityMalware Analysis

Drug Safety Associate
JAI AMBEY EMERGENCY SERVICES (I) PRIVATE LIMITED 2.00 to 7.00 Years Ahmedabad,Chennai, Kochi, Vishakhapatnam, Kolkata, Silchar, Tawang, Panna, Other Bihar, Other Karnat 29 Oct, 2024

Drug safety associate provides advice to case processing team in data entry of clinical trial SAEs into Argus safety database and to medical coding of adverse events and diseases according to Med...
pharmaceutical medicinemedical affairsclinical trialsdrug safetydrug accountabilitydrug regulatory affairsdrug monitoring

Assistant Sales Manager (BANCA)
ADITYA BIRLA SUN LIFE INSURANCE COMPANY LIMITED 0.00 to 3.00 Years Ahmedabad 29 Oct, 2024

Position: Assistant Sales Manager Department: TPD Banca Sales Job Summary: This position focuses on building and maintaining strong relations...
assistancebanca salessalesbancassurancelife insurance

Credit Manager Auto Loans
Taggd 2.00 to 7.00 Years Ahmedabad,Indore, Ranchi, Patna 29 Oct, 2024

Hiring Credit Manager and Area Credit Manager in Auto Loans/ Vehicle Loans Domain. All India opening. Locations Ranchi, Indore, Ahmedabad, Guwahati, Andhra Pradesh, Bihar. Duties & Resp...
vehicle loanscredit controlcredit analysiscredit risk

Telecaller
Indian School of Business Management and Administration Pvt Ltd 0.00 to 3.00 Years Pune 24 Oct, 2024

- Cold Calling to students regarding Admissions. - Review and assess student eligibility criteria for admission purposes. - Provide prospective students with information related to enrollment pr...
telecallingtelesalesinside salesadmission counsellingcold callinglead generation

Hiring for Parent Relationship Manager Kalyani Nagar Pune
HR Globe Recruitment Service 2.00 to 7.00 Years Pune 24 Oct, 2024

Dear Candidates, Hiring for Parent Relationship Manager Kalyani Nagar Pune CTC: Rs.30000-Rs.40000 incentives This is a full-time position. Working hours would be from 8:30 am - 4:30 pm Monday ...
preschoolcold callingparent-child relationshipspre-ksalesadmission counselling

Laboratory Technicians
SPENTO PAPERS (INDIA) LLP 2.00 to 7.00 Years Pune,Ethiopia, Burkina Faso, Gambia, Cameroon, Congo, Bangalore, Noida, Chennai, Philippines, Togo, 24 Oct, 2024

We are looking for a meticulous lab technician who will be responsible for supporting our laboratory staff with the primary goal of optimizing lab procedures and succeeding in producing reliable ...
microbiologycustomerorganizationteamworkchemistrycalibrationtestscommunicationanalyticaltimemanagementservicelaboratoryattention

Loan Review-Lead Analyst (SME)
locus enterprises 8.00 to 13.00 Years Pune,Bangalore, Chennai, Gurugram, Mumbai City 24 Oct, 2024

SME Loan Review

8 years of experience in loan review of commercial credit (mandatory CRE, and C&I) with good understanding of risk policies and framework,...
crecommercial credit

Refrigeration Technician
F Gheewala Human Resources Consultants Hiring For A Multinational Company 4.00 to 0.00 Years Pune,Bangalore, Chennai, Noida, Hyderabad, Kolkata, Gurugram, Mumbai City, Delhi, Saudi Arabia 24 Oct, 2024

HVAC Professional For A multinational company with a Global Presence Saudi Arabia

Job Title: Refrigeration Technician

Salary Range:...
refrigeration systemsventilationcooling waterrefrigeration

Vb.net Developer
Acura Solutions 5.00 to 8.00 Years Pune,Bangalore, Chennai, Noida, Hyderabad, Kolkata, Gurugram, Mumbai City, Delhi 24 Oct, 2024

We are seeking a skilled VB.NET / C# and SQL Server Developer with a minimum of 5 years of hands-on experience. The ideal candidate must have strong expertise in VB.NET, along with solid experien...
.net frameworkt-sqlvb.netsql

Hospital Administrator and admin staffs
Freelancerroshan 0.00 to 4.00 Years Pune,Bangalore, Chennai, Hyderabad, Canada, Kolkata, Mumbai City 24 Oct, 2024

We are looking for a responsible Hospital Administrator to coordinate our medical services. For this role, you should understand healthcare regulations and be able to handle medical information ...
administration managementgeneral administrationmanagement

Recruitment Manager
SPENTO PAPERS (INDIA) LLP 18.00 to 24.00 Years Pune,Bangalore, Chennai, Noida, Hyderabad, Kolkata, Gurugram, Mumbai City, Delhi, Itanagar 24 Oct, 2024

We are looking for a Recruitment Manager to design and oversee our companys hiring. Recruitment managerswill work closely with our recruiters to manage sourcing, interviewing and employment proc...
recruitmentclientprocesscoldcustomerbusinessservicesystemstrackingdevelopmentresourcesapplicantstrategiesrelationshipssatisfactioncalls

Management Information System (MIS)
Karan Kothari Jewellers PvtLtd 2.00 to 6.00 Years Nagpur,Other Maharashtra 24 Oct, 2024

Job Summary: JOB description: Creating MIS documentation related to Scheme to facilitate efficient operations and simple system upkeep Ensuring the privacy of all customers, employees and compa...
MIS documentationPrivacy managementComputer systems efficiency assessmentIMPS Receipts trackingCompetition managementCoordination with other departments

Territory Manager EDS - Nagpur, India
Dentsply Sirona 3.00 to 7.00 Years Nagpur,Other Maharashtra 24 Oct, 2024

Dentsply Sirona is the worlds largest manufacturer of professional dental products and technologies, with a 130-year history of innovation and service to the dental industry and patients worldwide...
Customer Relationship ManagementSalesProduct KnowledgeMarket AnalysisCustomer Service

Junior Accountant
PETAGMA PRIVATE LIMITED 1.00 to 5.00 Years Nagpur,Other Maharashtra 24 Oct, 2024

Key Responsibilities: General Ledger Maintenance: Assist in maintaining and updating the general ledger. Record financial transactions accurately and in accordance with established procedures. ...
AccountingFinancial ReportingExpense ManagementBank ReconciliationAccounts ReceivableBudgetingComplianceMicrosoft ExcelTally

Pre-Sales Manager
PEB 360 Solutions 2.00 to 6.00 Years Nagpur,Other Maharashtra 24 Oct, 2024

Experience required- 2-4 years Job Summary: The Pre Sales Manager in the Pre-Engineered Buildings (PEB) industry is responsible for managing and executing the pre-sales process, including identif...
Communication SkillsLead GenerationTechnical SupportSolution DesignFeasibility StudiesCustomer EngagementBid ManagementMarket AnalysisTrainingDevelopmentDocumentationReportingPreSales ManagementPEB SystemsTechnical Expertise

PREV
NEXT

organizing applicant information Job Openings

Responsibilities Administer compensation and benefit plans Assist in talent acquisition and recruitment processes Conduct employee onboarding and help organize t... inductionhr coordinationemployee orientationhr assistanceattendance managementemployee engagementjoining formalitieshr generalist

What does an office assistant do

Lease Administrator

HR Officer Responsibilities:

What does an office assistant do

Lease Administrator

Responsibilities Administer compensation and benefit plans Assist in talent acquisition and recruitment processes Conduct employee onboarding and help organize t... inductionhr coordinationemployee orientationhr assistanceattendance managementemployee engagementjoining formalitieshr generalist

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Responsibilities

Administer compensation and benefit plans

Assist in talent acquisition and recruitment processes

Conduct employee onboarding and help organize t...
inductionhr coordinationemployee orientationhr assistanceattendance managementemployee engagementjoining formalitieshr generalist

Responsibilities

Administer compensation and benefit plans

Assist in talent acquisition and recruitment processes

Conduct employee onboarding and help organize t...
inductionhr coordinationemployee orientationhr assistanceattendance managementemployee engagementjoining formalitieshr generalist