process adherence jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

process adherence Job Openings

Showing 20451 - 20500 of 56201 Jobs

Urgent | Hiring SME(Ticketing) & SME (Sales) in Delhi & Gurugram

Sharda Consultancy Services 1.00 to 6.00 Years Gurugram,Delhi, Faridabad, Noida 01 Apr, 2025

subject matter expertise

Required Tele Caller Dayshift

Sharda Consultancy Services 0.00 to 2.00 Years Gurugram,Delhi, Noida 01 Apr, 2025

Required Female Tele Caller for outbound domestic process.

Mechanical Supervisor

Xperts Manpower Solutions Enterprises Hiring For Japanese MNC Fresher Gurugram,Delhi, Faridabad, Noida 01 Apr, 2025

machine shop

machine assembly

quality engineering

mechanical maintenance

mechanical engineering

assembly shop

process inspection

production engineering

Senior Quality Engineer

Xperts Manpower Solutions Enterprises Hiring For MNC Automotive Company 0.00 to 2.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida, Manesar, Kundli 01 Apr, 2025

mechanical engineering

audit documentation

production planning control

new product development

production engineering

quality control

thermoforming

production scheduling

Sr.Finance Manager

Confidential 10.00 to 15.00 Years Gurugram 01 Apr, 2025

We are Hiring for Senior Finance Manager - SahiBandhu FinTech Services ( The Manipal Group)

About Us:-

stakeholder management

erp software

Relationship Manager

CAREER AHEAD 1.00 to 4.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

Key Responsibilities: field salesgold valuationgold loan operationsgold loanbfsi salesrelationship managerrelationship officersales manager

Accountant
PLACEMENT EXPERT Hiring For Congo DRC 4.00 to 9.00 Years Gurugram,Delhi, Bangalore, Chennai, Hyderabad, Vijayawada, Pune, Mumbai City 01 Apr, 2025

We have a requirement for Accountant with our client which Internet service provider in Kinshasa, Democratic Republic of the Congo. Position: Accountant englishaccounting

Mechanical Engineer Fresher
Sanskar HR Consultancy Services Hiring For Manufacturing Industry 0.00 to 1.00 Years Gurugram,Noida 01 Apr, 2025

Urgent Hiring for B.tech/Diploma Mechanical Engineer Job Description Total Vacancies: - 60 Dear Candidates Your Resume Is Shortlisted for Automobile & Manufa...
qualitydiplomamechanicalproductionmaintenance

Freelance Recruiter and Intern
KKD Consulting Hiring For KKD 0.00 to 1.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida, Sonipat, Palwal, Mumbai City, Meerut 01 Apr, 2025

Job Title: Freelance Recruiter & Recruitment Intern Location: Remote Job Type: Freelance / Internship
About Us:
[Y...
callingscreening

Sr HRBP Associate -Gurugram
MEGMA SERVICES 3.00 to 6.00 Years Gurugram 01 Apr, 2025

Leading engineering and construction company requires Sr HRBP Associate - Gurugram One of our client luxury brand which is Indias leading manufacturer of premium doors, windows, wood house and t...
hr operationshrbpassociate

Lead Generation Expert
Team Vertex India Global Services Private Limited Hiring For Lead Generation Expert 1.00 to 5.00 Years Gurugram,Delhi 01 Apr, 2025

Job Title: Lead Generation Expert Location: Gurgaon Job Summary: We are looking for a proactive and results-driven Lead Generation Expert to ...
voice processinternational call centertelecom salesinternational salesinternational bpoverizonatnt

Marketing Executive
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Bhagalpur, Hyderabad, Pune, Patna, Guwahati 01 Apr, 2025

Marketing executives coordinate and oversee campaigns geared at promoting products, services, and causes. Marketing executives are adept at a variety of platforms, including print and social med...
marketing researchmarketing communicationmarketing managementbrand managementmarketing

Cnc Machinist
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Faridabad, Ambala, Hyderabad, Dhubri, Chandigarh, Bhillai, Silvassa, Guwahati 01 Apr, 2025

Job brief We are looking for a competentCNC Operatorto use computer numerically controlled (CNC) machinery safely and accurately to perform a variety of functions. Your job i...
cnc maintenanceconstructionengineeringconstruction engineeringconstruction equipmentcnc programmingcnccnc manufacturing

Hiring For Online Marketing Executive (Work From Home Or Office Both) DELHI-NCR
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 01 Apr, 2025

Dear Candidate Greetings fromDesnor Destination Pvt Ltd ! Job Summary Idealises Internet Marketing Agency is looking for Marketing Executive to join our dynamic team and embark on a rewarding...
marketing planningdigitaldisplay advertisingmarketingfreelancingwork from homemarketing communicationpart time

Phone Banking Officer
EBIXCASH GLOBAL SERVICES PRIVATE LIMITED 0.00 to 1.00 Years Noida 01 Apr, 2025

Payroll Company Name : - Ebixcash Global Services. www.ebixcashglobalservices.com Were hiring Male / Female Fresher and experienced candidates for Ebixcash Process ( Customer ...
tamil speakingtelugukannadatele sales excecutive

Quality Assurance Engineer
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 3.00 to 8.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

The QA technician role plays an important part in our companys product development process. Our ideal candidate will be responsible for conducting tests before product launches to ensure softwar...
automation testingmanual testingprocessqa analystquality analysttest engineerqualitytestingtest managerqa manager

German Language Specialist
Wroots Global Private Limited 1.00 to 6.00 Years Gurugram,Jaipur 01 Apr, 2025

Job Title: German Language Specialist International Voice Support Location: Jaipur & Gurgaon voice supportinternational voicecall centre voiceinternational bpogerman translationvoice processcustomer care

Labourer
ASSETCARE SERVICES PRIVATE LIMITED 1.00 to 5.00 Years Gurugram,Faridabad, Ghaziabad, Noida, Bangalore, Ongole, Chennai, Hyderabad, Kolkata, Patna 01 Apr, 2025

General laborers perform manual duties set out by supervisors. General laborers responsibilities include working with power tools, maintaining a clean work environment and receiving goods. ALabor...
communicationtechnologyliteracybasicinstructionsnumeracyfollowskillsstamina

Account Management Director
SPENTO PAPERS (INDIA) LLP 12.00 to 22.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Tadepalligudem, Mumbai City 01 Apr, 2025

We are seeking an experienced Account Management Director to lead and optimize our Account Management team. This leadership role will focus on driving customer success and revenue growth, ensuri...
medicaresalesservicemedicaidcustomerbusinessdevelopmentoversightprocessimprovement

Plant Engineer
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 12.00 to 22.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Nellore, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

We are looking for a Plant Manager to drive continuous improvement and optimization of all processes.
Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla...
project engineeringprocess equipmentengineering processengineeringplant engineering

NTT DATA Virtual Drive Hedge Fund Gurgaon
NTT DATA INFORMATION PROCESSING SERVICES PRIVATE LIMITED 1.00 to 3.00 Years Gurugram 01 Apr, 2025

NTT DATA is Hiring experienced candidates for Hedge Fund Accounting domain. Location:Gurgaon Sector 48 (Candor Techspace) Work from Office Only Shift ...
reconciliationhedge fundsnav calculationinvestment banking

Project Supervisor
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 10.00 to 18.00 Years Thiruvanananthapuram,Bangalore, Chennai, Noida, Hyderabad, Kolkata, Gurugram, Agartala, Mumbai City, 01 Apr, 2025

We are looking for a responsibleSupervisorto oversee the workflow at our facilities. The role is acomplex one. He/She will not just be someone who supervises the work of others. ...
project managementtechnical skillscontract managementconstruction managementquality assurance

Operations Manager
WorkMint 0.00 to 4.00 Years Ernakulam,Idukki, Kannur, Kochi, Kottayam, Malappuram, Palakkad, Pathanamthitta, Thrissur, Wayanad 01 Apr, 2025

WorkMint Hiring For Banking Operations Manager Job Description Supervise and lead a team of banking professionals, providing guidance and support. Monitor and analyze operational perfo...
back officeoperationsbackend operationsback office operationsback office processing

Procurement Assistant
SHARMA ENTERPRISES 1.00 to 6.00 Years Ernakulam,Kochi, Kozhikode, Malappuram, Thrissur, Gwalior, Indore, Bokaro, Ranchi, Bhopal 01 Apr, 2025

We are currently searching for a Procurement Assistant supports the purchasing and supply chain processes, assisting with tasks like sourcing suppliers, preparing purchase orders, maintaining pro...
purchase operationssupplier quality assurancesourcing materialsinventory managementrecord maintenancedata analysisrecord keeping

Technical Content Writer ( 1 year Exp. )
Zennode Technologies 1.00 to 5.00 Years Kozhikode,Other Kerala 01 Apr, 2025

Calicut As an ideal candidate, you should have proven experience in a highly technical field, such as software development, computer science, or engineering. Your ability to evaluate and analyze ...
software developmentcomputer scienceengineeringwritten communicationverbal communicationuser experience designUI design

NOMD Technologies - Full Stack Developer - .Net/AngularJS
NOMD Technologies 4.00 to 8.00 Years Kochi,Other Kerala 01 Apr, 2025

Full Stack Developer-Immediate Joiners. Job Description. We are seeking a skilled Full Stack Developer with minimum 3.5 years of expertise in of ASP.NET Core, the latest Angular versions, Entit...
AngularEntity FrameworkLINQSQLJavaScriptHTML5CSS3GitAgile methodologiesASPNET CoreMediator Pattern

Finance Administration Analyst
ASSETCARE SERVICES PRIVATE LIMITED 1.00 to 5.00 Years Kottayam,Bangalore, Chennai, Ghaziabad, Hyderabad, Kolkata, Gurugram, Faridabad, Mangalore, Ahmedaba 01 Apr, 2025

Financial Management Analysts examine budget estimates for completeness, accuracy, and conformance with procedures and regulations. Analyze budgeting and accounting reports. Afinancial analyst tr...
analysissoftwareaccountingdataexcelcommunicationcollaborationmodelingspreadsheetfinancialmathematical

Chemical Engineer
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 10.00 to 18.00 Years Thiruvanananthapuram,Bangalore, Chennai, Hyderabad, Gurugram, Kolkata, Mumbai City, Delhi, Other Kar 01 Apr, 2025

We are looking for a creative, cooperative chemical engineer with a wealth of technical and industry knowledge and a talent for process optimization. The chemical engineer will work in the office...
communication skillscreativityanalytical skillsproblem-solving skills

Relationship Manager
CAREER AHEAD 1.00 to 4.00 Years Delhi,Noida, Bangalore, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City 01 Apr, 2025

Dear candidate, We are hiring Sales Manager/ Relationship Manager. Experience: 1 year CTC: as per industry standards Location: Pan India
field salesgold valuationbfsi salesgold loan operationsgold loanrelationship managersales managerloan manager

Required Tele Caller Dayshift
Sharda Consultancy Services 0.00 to 2.00 Years Delhi,Noida, Gurugram 01 Apr, 2025

Required Female Tele Caller for outbound domestic process.Good communication skills Salary - upto 15k working days - 6 days (Sunday off ) Shift Time - 10 AM to 7 pm Salary date...
outbound marketingdomestic bpotelesalesbposales

customer service Executive
IMPACT UNIVERSAL XPERTS 0.00 to 1.00 Years Delhi,Ghaziabad, Noida 01 Apr, 2025

Key Responsibilities: - Respond to customer inquiries via phone, email, and chat - Resolve customer issues in a timely and effective manner - Provide accurate and concise information to customer...
customer serviceinbound processcustomer supportoutbound process

Mechanical Supervisor
Xperts Manpower Solutions Enterprises Hiring For Japanese MNC Fresher Delhi,Faridabad, Noida, Gurugram 01 Apr, 2025

We have an urgent requirement of Be Mechanical candidates for production and quality profile in automobile industries for manufacturing units candidates should be the fresher which will be haired...
machine shopmachine assemblyquality engineeringmechanical maintenancemechanical engineeringassembly shopprocess inspectionproduction engineering

Senior Quality Engineer
Xperts Manpower Solutions Enterprises Hiring For MNC Automotive Company 0.00 to 2.00 Years Delhi,Faridabad, Ghaziabad, Noida, Gurugram, Kundli, Manesar 01 Apr, 2025

Dear All candidates. We are hiring for Mnc Tier1 Automotive and Automobile manufacturers for Delhi Ncr locations. we are specialised and well experienced in Hiring for btech Mechanical Engineer...
mechanical engineeringaudit documentationproduction planning controlnew product developmentproduction engineeringquality controlthermoformingproduction scheduling

Relationship Manager
CAREER AHEAD 1.00 to 4.00 Years Delhi,Noida, Bangalore, Chennai, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City 01 Apr, 2025

Dear candidate, We are hiring for Sales Manager & Relationship Manager. Experience: 1 year CTC: as per industry standards incentives Location: Pan India
Key Responsibilities: field salesgold valuationgold loan operationsgold loanbfsi salesrelationship managerrelationship officersales manager

Urgent |International Sales Executives (Immigration Process) Okhla , Delhi
Sharda Consultancy Services 1.00 to 6.00 Years Delhi,Noida 01 Apr, 2025

Dear Candidates, We are lookingInternational Sales Executives (Immigration outbound sales ) in Okhla ,Delhi Salary upto 50k Medical Insurance Shift Time -12 pm to 9 pm Job description
...
customer supportupsellingsalesinternational bpoprocesslead generationvoice processsales supportimmigrationinternational voicetelesales

International Lead Generation
AVA PLACEMENT SERVICES 0.00 to 3.00 Years Delhi,Ghaziabad, Noida 01 Apr, 2025

Urgent Looking for- (International Outbound Process) Job Title: International Lead Generation Executive LOCATION- NOIDA SECTOR 1/2 NEAR BY METRO 15 NOIDA BOTH AR...
international call centerinternational voice processoutbound salescustomer serviceinternational bpocustomer supportinternational sales

Urgent Hiring for Personal Loan Sales Executive
AASAANJOBS PRIVATE LIMITED Hiring For AASAANJOBS PRIVATE LIMITED 1.00 to 5.00 Years Delhi 01 Apr, 2025

A well-defined job description sets clear expectations and attracts suitable candidates. Below is a template tailored for a Loan Sales Executive role: Job T...
loan salespersonal loans

Regional sales director- Reasl estate and project sales
MEGMA SERVICES 10.00 to 20.00 Years Delhi,Noida, Gurugram 01 Apr, 2025

Leading Engineering and construction company requires Regional sales Director( Real estate) - Dehi/ Gurugram/Noida We are looking out for Regional sales director ( Real estate and Project sales)...
project salesdirector salesregional sales manager

Structural Engineer
LEADZN PRIVATE LIMITED 10.00 to 20.00 Years Delhi,Noida, Zimbabwe, Mozambique, Afghanistan, Bangalore, Chennai, Hyderabad, Gurugram, Kolkata, Pu 01 Apr, 2025

We are seeking a skilled and experienced structural engineer to join our team and take charge of overseeing our construction projects. Your primary responsibility will be to ensure the safety and...
architecturecommunicationanalyticalengineeringdesignproblemmanagementstructuralsolvingprojectcollaborateability

Account Management Director
SPENTO PAPERS (INDIA) LLP 12.00 to 22.00 Years Delhi,Noida, Bangalore, Chennai, Hyderabad, Gurugram, Kolkata, Pune, Tadepalligudem, Mumbai City 01 Apr, 2025

We are seeking an experienced Account Management Director to lead and optimize our Account Management team. This leadership role will focus on driving customer success and revenue growth, ensuri...
medicaresalesservicemedicaidcustomerbusinessdevelopmentoversightprocessimprovement

Onroll Interview | Immediate Joining | Relationship Manager- Home Loan Sales
Veerwal Getwork Services Private Limited 1.00 to 6.00 Years Delhi,Faridabad, Ghaziabad, Noida, Jaipur, Indore, Gurugram, Pune 01 Apr, 2025

Dear Applicants. Greetings of the Day! We are glad to inform you about the job opening in Sr.RM | RM for below mentioned Job Role: Urgent Interview! Timing: 10.00 AM - 1.00 P...
sales processfield work

Plant Engineer
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 12.00 to 22.00 Years Delhi,Noida, Bangalore, Chennai, Nellore, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City 01 Apr, 2025

We are looking for a Plant Manager to drive continuous improvement and optimization of all processes.
Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla...
project engineeringprocess equipmentengineering processengineeringplant engineering

Engineering Executive
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 11.00 to 21.00 Years Delhi,Faridabad, Noida, Bhagalpur, Chandigarh, Bhillai, Patna, Muzzafarpur, Korba, Ahmedabad 01 Apr, 2025

We are seeking a highly skilled and experienced Engineering Manager to join our team. In this role, you will be responsible for leading and coordinating multiple projects across diverse teams. Yo...
engineeringground improvementconstruction engineeringpavement engineeringearned value management

German Language Specialist
Wroots Global Private Limited 1.00 to 6.00 Years Jaipur,Gurugram 01 Apr, 2025

Job Title: German Language Specialist International Voice Support Location: Jaipur & Gurgaon voice supportinternational voicecall centre voiceinternational bpogerman translationvoice processcustomer care

TechMahindra is Hiring CSA for Banking Process
Tech Mahindra Ltd 0.00 to 4.00 Years Noida 01 Apr, 2025

Mega Walk-in drive|| Tech Mahindra-Banking Process|| Noida sec-62 Dear Candidate, Mega Walk-in drive at Tech Mahindra for Voice Process (Work from office). customer servicetelecallingbanking salescustomer care

Product Manager
uEngage 3.00 to 7.00 Years Chandigarh 01 Apr, 2025

Role Overview We are seeking a dynamic and results-driven Product Manager to join our team in Chandigarh. As a Product Manager, you will own the product lifecycle, from ideation to execution, and...
Product ManagementMarket ResearchStakeholder ManagementQuality AssurancePerformance MonitoringUserCentered Design

Operations Manager - Immigration
IMygrate 2.00 to 6.00 Years Chandigarh 01 Apr, 2025

At IMygrate , we help individuals and families navigate the complex journey of Canadian immigration. With offices in Canada and India, we are known for our client-first approach, transparent proce...
Operations ManagementTeam ManagementCommunication SkillsProject ManagementOrganizational SkillsTechsavvy

Senior Architect
Rajdeep and Company Infrastructure Pvt Ltd 3.00 to 7.00 Years Chandigarh 01 Apr, 2025

Key Responsibilities: 1. Design and Planning: Develop architectural designs and plans for various projects including residential, commercial, and industrial structures. Conduct feasibility stud...
Technical SkillsProject ManagementCommunication

Customer Sales Executive - Two Wheeler Loans - Chandigarh - Sector 17 B - CSE
Tata Capital 2.00 to 6.00 Years Chandigarh 01 Apr, 2025

Perform the following under the guidance/direction of Supervisor/Manager With help of Supervisor/ Manager, Identify the customers for protentional Business Collect the documents from Customers a...
Relationship DevelopmentComplianceCustomer IdentificationDocument ValidationCase LoggingDisbursement ProcessSanction Ratio FulfilmentCrosssellingVendor Empanelment

HR Recruiter Executive
Busibud Solutions Private Ltd 0.00 to 4.00 Years Chandigarh 01 Apr, 2025

Job Details* The candidate needs to have excellent skills as far as written communication in English is concerned. We handle several overseas processes and this job would involve communication wi...
HR managementHR analytics

PREV
NEXT

process adherence Job Openings

Key Responsibilities: field salesgold valuationgold loan operationsgold loanbfsi salesrelationship managerrelationship officersales manager

About Us:

Job brief We are looking for a competentCNC Operatorto use computer numerically controlled (CNC) machinery safely and accurately to perform a variety of functions. Your job i... cnc maintenanceconstructionengineeringconstruction engineeringconstruction equipmentcnc programmingcnccnc manufacturing

Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla... project engineeringprocess equipmentengineering processengineeringplant engineering

Key Responsibilities: field salesgold valuationgold loan operationsgold loanbfsi salesrelationship managerrelationship officersales manager

Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla... project engineeringprocess equipmentengineering processengineeringplant engineering

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Job brief We are looking for a competentCNC Operatorto use computer numerically controlled (CNC) machinery safely and accurately to perform a variety of functions. Your job i...
cnc maintenanceconstructionengineeringconstruction engineeringconstruction equipmentcnc programmingcnccnc manufacturing

Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla...
project engineeringprocess equipmentengineering processengineeringplant engineering

Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla...
project engineeringprocess equipmentengineering processengineeringplant engineering