solid understanding jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

solid understanding Job Openings

Showing 25501 - 25550 of 41447 Jobs

Flutter Mobile App Developer

FoundersCaffe 2.00 to 6.00 Years Udaipur,Other Rajasthan 12 Nov, 2024

Dart programming language

Data Entry Operator Computer Operator Work From Home

Learning Planner Hiring For Data Entry, Back Office, Work From Home 0.00 to 4.00 Years Ranchi,Patna, Jaipur, Indore, Raipur, Other Madhya Pradesh, Thiruvanananthapuram, Chandigarh, Guwaha 12 Nov, 2024

Learning Planner

Data Entry Executives

work from home typing

work from home

data entry

data entry typing

back office operations

back office

home based data entry

data entry work from home

Data Entry Operator Computer Operator Work From Home

Learning Planner Hiring For Data Entry, Back Office, Work From Home 0.00 to 4.00 Years Raipur,Jaipur, Indore, Other Madhya Pradesh, Thiruvanananthapuram, Chandigarh, Ranchi, Patna, Guwaha 12 Nov, 2024

Learning Planner

Data Entry Executives

work from home typing

work from home

data entry

data entry typing

back office operations

back office

home based data entry

data entry work from home

MECHANICAL TECHNICIAN

BHA FOODS PRIVATE LIMITED 7.00 to 12.00 Years Pondicherry,Coimbatore, Chennai, Bangalore, Other Maharashtra, Other Tamil Nadu, Hyderabad, Thane, P 12 Nov, 2024

Job description

Mechanical Technician Job Description Template We are seeking a highly-skilled mechanical technician to assist our en...
manufacturingdesigntechnicalequipmenttelecommachinerymanufacturing engineeringengineersmaintenancemechanicaltrainingprocesshardwareassistindustries.maintaintechnicianengineerproducts

MECHANICAL TECHNICIAN

BHA FOODS PRIVATE LIMITED 7.00 to 12.00 Years Pune,Other Maharashtra, Thane, Bangalore, Other Tamil Nadu, Chennai, Hyderabad, Pondicherry, Coimbat 12 Nov, 2024

Job description

Mechanical Technician Job Description Template We are seeking a highly-skilled mechanical technician to assist our en...
manufacturingdesigntechnicalequipmenttelecommachinerymanufacturing engineeringengineersmaintenancemechanicaltrainingprocesshardwareassistindustries.maintaintechnicianengineerproducts

Electrical Engineer

AES INDUSTRIAL PRIVATE LIMITED 6.00 to 11.00 Years Pune,China, Bangladesh, Other Bihar, Qatar, Other Goa, Other Arunachal Pradesh, South Korea, Other A 12 Nov, 2024

Interior Designer in Udaipur

Furnario Furniture Pvt Ltd 2.00 to 6.00 Years Udaipur,Other Rajasthan 12 Nov, 2024

AutoCAD

for RDM in Life Insurance Salary 4Lac

Niyukti Management Consultants Hiring For Niyukti Management Consultants 4.00 to 9.00 Years Udaipur,Jodhpur, Ajmer, Jaipur, Alwar, Noida, Gurugram, Faridabad, Delhi, Agra 12 Nov, 2024

RDM For Agency Sales Life Insurance Salary 4Lac

Delhi

, Noida,Gurgaon ,Jipur,Jodhpur,Alwar,Udaipur,Ajmer ,Agra,Faridabad

Exp.3...
agency channelgeneral insurancetied channelpharma saleshealth insuranceagency salessaleslife insurancedirect salesbancassurancesales development managerdevelopment managersales executivesales managerunit managerarea sales managerrelationsh

Digital Marketing Executive (Immediate Joiner)
Venturesathi Business Services LLP 1.00 to 5.00 Years Rourkela 12 Nov, 2024

Job Title: Digital Marketer (SEO, SMM, Zoho CRM) We are looking for a highly skilled and experienced Digital Marketer to join our team and help us grow our online presence through effective SEO a...
SEOSMMKeyword ResearchAnalyticsContent CreationEmail MarketingSocial Media ManagementDigital AdvertisingData AnalysisHTMLCSSJavaScriptGoogle AnalyticsZoho CRM

HR Operations
GDFS Group 5.00 to 9.00 Years Bhubaneswar 12 Nov, 2024

Job Title: HR and Operations Manager Location: Bhubaneswar Department: Operations Salary: 3LPA Job Summary: The HR and Operations Manager will oversee the integration of HR functions with ope...
Operational ManagementHR ManagementRegulatory ComplianceStrategic PlanningTeam ManagementFinancial OversightLeadershipCommunicationInterpersonal SkillsAnalytical Skills

Data Modeler
Accenture 8.00 to 12.00 Years Bhubaneswar 12 Nov, 2024

Project Role : Data Modeler Project Role Description : Work with key business representatives, data owners, end users, application designers and data architects to model current and new data. Must...
Dimensional ModelingData EngineeringRDFOntologyData AnalyticsData Modeling TechniquesMethodologiesCloud Database Modeling3NF modelingData Architecture PrinciplesDB designData Vault ModelingBusiness Data Vault ModelingCloud DB DesignBuildClo

Hiring For Business Manager
Niyukti Management Consultants Hiring For Niyukti Management Consultants 4.00 to 9.00 Years Bhubaneswar,Varanasi, Jaipur, Kanpur, Lucknow, Gurugram, Kolkata, Ludhiana, Delhi, Agra 12 Nov, 2024

Post - Business Manager(Insurance) Location ,Delhi,Gurgaon,Agra,Lucknow,Kanpur,Ludhiana,Varansi,Kolkata, Jaipur,Bhubneshwer Salary- Upto 3lac ...
life insurancedirect salessalessales officerarea sales managersales manageragency development manageragency manager

Alert Hiring Urgent requirement Agency Sales ( Life Insurance)
Niyukti Management Consultants Hiring For None 3.00 to 8.00 Years Bhubaneswar,Kolkata, Gurugram, Patiala, Amritsar, Jalandhar, Ludhiana, Chandigarh, Delhi, Guwahati 12 Nov, 2024

ASM- Agency Sales Manager Life Insurance Co. Ltd. Salary upto- 3Lac Exp 3-10 Year Sales, Location Delhi/NCR,Kolkata,Gorgaon ,Ludhiana,Patiala,Amritsar,Jalanadhar,Chandigarh,Guwahati,Bhubneshw...
saleslife insurancedirect saleshealth insurancegeneral insurancechannel salesagency salesautomobile salesdistribution manageragency development managersales officerdevelopment manageragency managerunit managerbusiness development managersal

Salesforce Technical Lead - Apex/Visual Force
Teqfocus 7.00 to 11.00 Years Ranchi,Other Jharkhand 12 Nov, 2024

Overview We are looking for an experienced and dynamic Salesforce Technical Lead with 7 years of hands-on expertise in Salesforce development and architecture. In this role, you will lead the end...
VisualforceRESTSOAPMulesoftContinuous integrationApexLightning Web Components LWCSalesforce integrationsAPI integration toolsSalesforce Sales CloudService CloudExperience CloudSalesforce certificationsDevOps processesContinuous deployment

Mobile Application Developer
Raneso 2.00 to 6.00 Years Ranchi,Other Jharkhand 12 Nov, 2024

About The Company Raneso is a software company specializing in the creation of custom IT solutions for web, mobile, and desktop. We offer visually engaging and user-centric interactive solutions...
RESTful APIsWebSocketsGitBitbucketFirebaseAWSautomated testingcontinuous integrationFlutterDart programmingCICDGraphQLAndroid design principles

Data Entry Operator Computer Operator Work From Home
Learning Planner Hiring For Data Entry, Back Office, Work From Home 0.00 to 4.00 Years Ranchi,Patna, Jaipur, Indore, Raipur, Other Madhya Pradesh, Thiruvanananthapuram, Chandigarh, Guwaha 12 Nov, 2024

Learning Planneris seeking enthusiastic individuals to join our team asData Entry Executivesfor remote work. This is an excellent opportunity for housewives, ret...
work from home typingwork from homedata entrydata entry typingback office operationsback officehome based data entrydata entry work from home

Credit Manager Auto Loans
Taggd 2.00 to 7.00 Years Ranchi,Patna, Indore, Ahmedabad 12 Nov, 2024

Hiring Credit Manager and Area Credit Manager in Auto Loans/ Vehicle Loans Domain. All India opening. Locations Ranchi, Indore, Ahmedabad, Guwahati, Andhra Pradesh, Bihar. Duties & Resp...
vehicle loanscredit controlcredit analysiscredit risk

Chemical Specialist
bhuranichem industries 0.00 to 4.00 Years Raipur 12 Nov, 2024

Company Description we suggest you enter details here Role Description This is a full-time Chemical Specialist role at Bhuranichem Industries in Raipur, with flexibility for some remote work. A...
ChemistryChemical EngineeringChemical AnalysisResearchDevelopmentAnalytical SkillsCommunicationTeamworkLaboratory ProceduresSafety Protocols

Data Entry Operator Computer Operator Work From Home
Learning Planner Hiring For Data Entry, Back Office, Work From Home 0.00 to 4.00 Years Raipur,Jaipur, Indore, Other Madhya Pradesh, Thiruvanananthapuram, Chandigarh, Ranchi, Patna, Guwaha 12 Nov, 2024

Learning Planneris seeking enthusiastic individuals to join our team asData Entry Executivesfor remote work. This is an excellent opportunity for housewives, ret...
work from home typingwork from homedata entrydata entry typingback office operationsback officehome based data entrydata entry work from home

MECHANICAL TECHNICIAN
BHA FOODS PRIVATE LIMITED 7.00 to 12.00 Years Pondicherry,Coimbatore, Chennai, Bangalore, Other Maharashtra, Other Tamil Nadu, Hyderabad, Thane, P 12 Nov, 2024

Job description
Mechanical Technician Job Description Template We are seeking a highly-skilled mechanical technician to assist our en...
manufacturingdesigntechnicalequipmenttelecommachinerymanufacturing engineeringengineersmaintenancemechanicaltrainingprocesshardwareassistindustries.maintaintechnicianengineerproducts

MECHANICAL TECHNICIAN
BHA FOODS PRIVATE LIMITED 7.00 to 12.00 Years Pune,Other Maharashtra, Thane, Bangalore, Other Tamil Nadu, Chennai, Hyderabad, Pondicherry, Coimbat 12 Nov, 2024

Job description
Mechanical Technician Job Description Template We are seeking a highly-skilled mechanical technician to assist our en...
manufacturingdesigntechnicalequipmenttelecommachinerymanufacturing engineeringengineersmaintenancemechanicaltrainingprocesshardwareassistindustries.maintaintechnicianengineerproducts

Electrical Engineer
AES INDUSTRIAL PRIVATE LIMITED 6.00 to 11.00 Years Pune,China, Bangladesh, Other Bihar, Qatar, Other Goa, Other Arunachal Pradesh, South Korea, Other A 12 Nov, 2024

We are looking for an electrical engineer who will help us advance our electrical products, systems, and applications. On a daily basis, youll carry out various engineering tasks, such as perfor...
physicsmathematicsskills.criticalthinking.

Senior Accountant
OVERNET TRADING PRIVATE LIMITED 19.00 to 25.00 Years Nagpur,Aurangabad, Kalyan, Ambernath, Ratnagiri, Navi Mumbai, Ahmednagar, Sangli, Jalgaon, Mumbai Ci 12 Nov, 2024

We are looking for a detail-oriented senior accountant to perform and coordinate accounting duties within our organization. The senior accountants responsibilities include preparing financial rep...
structuralreliabilitylayoutcivilsystemsmechanicalassetseniorcontrolprocesspipingtreaterdriverproductleadaccountantelectricalchiefmanager

Engineering Technician
OVERNET TRADING PRIVATE LIMITED 19.00 to 25.00 Years Nagpur,Aurangabad, Kalyan, Navi Mumbai, Ahmednagar, Sangli, Jalgaon, North Goa, Mumbai City, Vasco D 12 Nov, 2024

We are searching for a driven, detail-orientated engineering technician to join our growing organization. The engineering technicians responsibilities include performing research, building protot...
compressionmaterialswelldrillingmanagementpipelineengineeringproductioncontrolsafetyprocessoperator/leaseplantscheduleroperatormechanictechnicianheadsr.engineerspec-response

Electrical Engineer
AES INDUSTRIAL PRIVATE LIMITED 6.00 to 11.00 Years Noida,China, Bangladesh, Other Bihar, Qatar, Other Goa, Other Arunachal Pradesh, South Korea, Other 12 Nov, 2024

We are looking for an electrical engineer who will help us advance our electrical products, systems, and applications. On a daily basis, youll carry out various engineering tasks, such as perfor...
physicsmathematicsskills.criticalthinking.

Biomedical Technician
LEADZN PRIVATE LIMITED 10.00 to 20.00 Years Pune,Zimbabwe, Mozambique, Bangalore, Noida, Chennai, United Arab Emirates, Hyderabad, Kolkata, Guru 12 Nov, 2024

We are looking for a dynamic biomedical technician to join our biomedical department. In this role, youll be in charge of overseeing the care and use of all biomedical equipment, performing machi...
biomedical engineeringhealthcarehealthcare operationsmedical equipment planningclinical engineeringcardiologybiomedicaltechnical processbiomedical electronicsnutritionistanalyst

Sales And Marketing Executive
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 9.00 Years Pune,Bangalore, Chennai, Noida, Hyderabad, Gurugram, Mumbai City, Delhi 12 Nov, 2024

Contributing to the development of marketing strategies.

Conducting market research on rival products.

Designing and implementing marketing plans for company products...
sales promotionbrandingsales managementpromotionsmarketing promotionsbrand promotion

Hotel Front Desk
AES INDUSTRIAL PRIVATE LIMITED 6.00 to 11.00 Years Pune,China, Bangladesh, Other Bihar, Qatar, Other Arunachal Pradesh, South Korea, Other Assam, Iraq, 12 Nov, 2024

We are looking for a Hotel Front Desk to serve as our guests first point of contact and manage all aspects of their accommodation. Hotel Front Desk Agent responsibilities include registering gue...
communication skillsfront desk reception

Marketing Executive
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 3.00 to 7.00 Years Pune,Bangalore, Noida, Chennai, Hyderabad, Gurugram, Mumbai City, Delhi 12 Nov, 2024

Responsibilities

Conceive and develop efficient and intuitive marketing strategies

Organize and oversee advertising/communication campaigns (social media, TV etc.), ...
advertisingbrandingsfdcarbitrationresearchvisualforcetriggerstrackingbusiness development

Assistant Manager Finance
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 6.00 Years Pune,Bangalore, Noida, Chennai, Hyderabad, Gurugram, Mumbai City, Delhi 12 Nov, 2024

Revenue Accounting:

Record and monitor revenue transactions to ensure they are recognized in the correct accounting periods.

Prepare and review journal entri...
advanced exceloperationstds calculationtallypreparationtdsvoucherbillingexcel reportprocurementfinancial reporting

Technical Account Manager
LEADZN PRIVATE LIMITED 6.00 to 11.00 Years Pune,Zimbabwe, Mozambique, Afghanistan, Bangalore, Chennai, Noida, Hyderabad, Kolkata, Gurugram, Mum 12 Nov, 2024

We are looking for a qualified Technical account manager to oversee and address our customers technical needs. You will provide accurate technical service before and after the point of sale, ensu...
electrical maintenanceconstruction engineeringcranecenterpetroleumsupportdesktopproductionconstructionplanneroperatortechniciancallprojectmanagerelectronic

Child Life Specialist
NEW ERA LIFE CARE PRIVATE LIMITED 11.00 to 21.00 Years Pune,Bangalore, Chennai, Noida, Nellore, Hyderabad, Gurugram, Kolkata, Mumbai City, Delhi 12 Nov, 2024

We are looking for a Child Life Specialist to join our team and help our pediatric patients have a more relaxing and effective recovery time while in our healthcare facility. Child Life Speciali...
collaborationleadershipcommunicationadvocacytherapydevelopmentpatienceemotionalservicesfamilylifeempathychildplayengaging

Bio-tech Research Associate / Scientist
NEW ERA LIFE CARE PRIVATE LIMITED 2.00 to 7.00 Years Pune,Iran, Zimbabwe, Mozambique, Jaipur, Bangalore, Iraq, Chennai, Noida, Hyderabad, Kolkata, Lebano 12 Nov, 2024

We are looking for a Biologist to join our team and conduct research and experiments to gain a better understanding about different biological organisms in nature. Biol...
sciencebiochemical engineeringresearch analysisbioprocessingmicrobiologybiochemistryneurostimulationmicrobiological analysisbiologics

Medical Coordinator
LEADZN PRIVATE LIMITED 10.00 to 20.00 Years Pune,Singapore, Zimbabwe, Mozambique, Afghanistan, Bangalore, Noida, Chennai, Hyderabad, Gurugram, K 12 Nov, 2024

We are searching for a medical coordinator to manage and maintain the smooth operations of our facilitys administration, scheduling, and patient admissions. In this role, you will be required to ...
officemdsmanagementsystemsfrontaccountingmedical billingseniorpurchasingwealthengineercoordinatoradministratormedicalassociateinformationconsultantvaluemanager

Electronics Design Engineer
AUTHENTIC ENCON PRIVATE LIMITED 1.00 to 5.00 Years Pune 12 Nov, 2024

This is Jhanvi Rajput from ASA (Authentic Staffing Agency) We are a leading HR Consultancy having more than 1500 employees on our payroll serving Major Sectors like Automobile,...
ms officeorcadautocadsolidworks

AutoCAD Design Specialist
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 9.00 Years Pune,Bangalore, Noida, Chennai, Hyderabad, Gurugram, Mumbai City, Delhi 12 Nov, 2024

Key Responsibilities:

Produce detailed and accurate technical drawings and plans using AutoCAD software.

Interpret and analyze design requirements and specif...
solid modelingcadmechanism designdesign for assemblysolid works

Data Engineer
HIPAAS INFOTECH PRIVATE LIMITED 5.00 to 10.00 Years Pune,Thane 12 Nov, 2024

Key Responsibilities:

Deliverables:

o Document foundational data tables to establish a robust data architecture. o Migrate and validate test tables to en...
data modelingsnow flakepythonsqlaws

collection manager
HAPPY SQUARE OUTSOURCING SERVICES PRIVATE LIMITED 5.00 to 8.00 Years Pune 12 Nov, 2024

Team Management: Lead, mentor, and manage a team of collection agents responsible for personal loan collections. Ensure team members meet performance targets and follow the collection process ef...
collection manager

Sales Manager Pune
ICICI HOME FINANCE COMPANY LTD 1.00 to 6.00 Years Pune 12 Nov, 2024

Job Title: Sales Manager (Home Loans & Mortgage Products)

As a Sales Manager for home loans and other mortgage products, you...
field salessales

Accounts Executive
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 9.00 Years Pune,Bangalore, Chennai, Noida, Hyderabad, Gurugram, Mumbai City, Delhi 12 Nov, 2024

Key Responsibilities:

Manage accounts payable and receivable processes, ensuring timely and accurate payments and collections.

Process and verify invoices, e...
balance sheetsales taxaccountstaxationfinancegstaudittallyauditing

Production Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 8.00 to 12.00 Years Pune,Bangalore, Chennai, Noida, Hyderabad, Gurugram, Mumbai City, Delhi 12 Nov, 2024

Roles and Responsibilities :

Plan, organize, and control daily production activities to meet customer requirements and company goals.

Ensure efficient use of...
factory managementfactory operationsproduction planning controlfmcg operations

Hr Service Associate
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 1.00 to 5.00 Years Pune,Bangalore, Chennai, Noida, Hyderabad, Gurugram, Mumbai City, Delhi 12 Nov, 2024

Job description

Good organizational and prioritisation skills

Analytical and problem-solving skills

Multi-cultural awareness

Passion for customer servi...
process documentationservice deliverycustomer serviceprocess improvementpresentation skillssuccessfactors

Fashion Designer
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 9.00 Years Pune,Bangalore, Chennai, Noida, Hyderabad, Gurugram, Mumbai City, Delhi 12 Nov, 2024

Design Creation: Develop original and innovative fashion designs for clothing, accessories, and footwear, ensuring alignment with seasonal trends and brand identity. fashion designingphotoshopcostume designing

Store Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 5.00 to 10.00 Years Pune,Bangalore, Noida, Chennai, Hyderabad, Gurugram, Mumbai City, Delhi 12 Nov, 2024

Key Responsibilities:

Lead and manage the day-to-day operations of the store, including sales, customer service, inventory management, and merchandising.

Dev...
inventory controlstore operationsstore planningsales strategycustomer servicestores maintenancestore keeping

Data Engineer - IICS
Taggd 5.00 to 7.00 Years Pune,Bangalore, Chennai, Mumbai City 12 Nov, 2024

Location:India (Mumbai/ Pune Preferred) Travel:As required Type of Employment: Full time Notice Period: datawarehousinginformaticacloud

Research And Development Analyst
TECHNOLOGY WORLD CREATER 2.00 to 6.00 Years Nagpur,Other Maharashtra 12 Nov, 2024

Company Description TECHNOLOGY WORLD CREATER, located in Nagpur, is a skill-based digital innovation school for all age groups. The focus is on learning new skills, building a network, collaborat...
GraphicsGraphic DesignLogo DesignBrandingImage EditingAdobe Creative SuiteCommunication SkillsUIUX projectsDesign SoftwareDesign Principles

Senior Account Manager - Sales (Nagpur)
Adventusio 2.00 to 6.00 Years Nagpur,Other Maharashtra 12 Nov, 2024

Your Family Adventus.io is a B2B2C SaaS-based marketplace supporting institutions, recruiters and students within the international student placement sector. Our innovative platform allows instit...
SalesBusiness DevelopmentRelationship ManagementCustomer Relationship Management

Finance/Accounting Analyst
Quantum Integrators 5.00 to 9.00 Years Nagpur,Other Maharashtra 12 Nov, 2024

Role: Finance/Accounting Analyst Location: Nagpur, Maharashtra (Onsite) Duration: Fulltime Shift: UK Shift Experience: 7 years mandatory Resource should have Finance / Accounting background a...
FinanceAccountingBudgetingAccrualsPOsPlanningSAPMS OfficeCommunication SkillsPresentation SkillsStakeholder ManagementReport GenerationPostingsResource TimesheetsBudget CalculationsAriba

Human Resources Intern
Ciferon 0.00 to 4.00 Years Nagpur,Other Maharashtra 12 Nov, 2024

Job description Ciferon is the simplest restaurant POS and management software that works online and offline both, integrated with leading platforms which provide the easy operations like: Billin...
RecruitmentNetworkingEmployee EngagementOrientationData ManagementOperations ManagementSafety ManagementHealth ManagementCommunication SkillsDescriptionsHR ActivitiesCV ReviewRecruitment Process

Senior Accountant
OVERNET TRADING PRIVATE LIMITED 19.00 to 25.00 Years Nagpur,Aurangabad, Kalyan, Ambernath, Ratnagiri, Navi Mumbai, Ahmednagar, Sangli, Jalgaon, Mumbai Ci 12 Nov, 2024

We are looking for a detail-oriented senior accountant to perform and coordinate accounting duties within our organization. The senior accountants responsibilities include preparing financial rep...
structuralreliabilitylayoutcivilsystemsmechanicalassetseniorcontrolprocesspipingtreaterdriverproductleadaccountantelectricalchiefmanager

PREV
NEXT

solid understanding Job Openings

Job description

Job description

Job description

Job description

Responsibilities Conceive and develop efficient and intuitive marketing strategies Organize and oversee advertising/communication campaigns (social media, TV etc.), ... advertisingbrandingsfdcarbitrationresearchvisualforcetriggerstrackingbusiness development

Job Title: Sales Manager (Home Loans & Mortgage Products)

Job description Good organizational and prioritisation skills Analytical and problem-solving skills Multi-cultural awareness Passion for customer servi... process documentationservice deliverycustomer serviceprocess improvementpresentation skillssuccessfactors

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Responsibilities

Conceive and develop efficient and intuitive marketing strategies

Organize and oversee advertising/communication campaigns (social media, TV etc.), ...
advertisingbrandingsfdcarbitrationresearchvisualforcetriggerstrackingbusiness development

Job description

Good organizational and prioritisation skills

Analytical and problem-solving skills

Multi-cultural awareness

Passion for customer servi...
process documentationservice deliverycustomer serviceprocess improvementpresentation skillssuccessfactors