understanding of local language jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

understanding of local language Job Openings

Showing 36851 - 36900 of 58175 Jobs

Recruitment Business Partner

NEW ERA LIFE CARE PRIVATE LIMITED 17.00 to 23.00 Years Noida,Delhi, Bangalore, Ongole, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City 29 Oct, 2024

Housekeeping Supervisor

NEW ERA LIFE CARE PRIVATE LIMITED 19.00 to 22.00 Years Noida,Delhi, Bangalore, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Port Blair 29 Oct, 2024

Ecommerce Specialist

Knack Consulting Services Private Limited 0.00 to 1.00 Years Noida,Delhi 29 Oct, 2024

Salesforce CPQ - Lead (Wipro)

Wroots Global Private Limited 7.00 to 12.00 Years Noida,Delhi, Bangalore, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City 29 Oct, 2024

Immediate Joiners or 30 Days Notice period is preferred.

Minimum 5 years of experience in Salesforce Sales & CPQ Cloud or any other CPQ Product salesforcelwccpq

Direct Channel Sales

RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 0.00 to 4.00 Years Mangalore,Hyderabad, Chennai, Bangalore, Guntur, Rajahmundry, Vijayawada, Vishakhapatnam, Amalapuram 29 Oct, 2024

Office Assistant

LEADZN PRIVATE LIMITED 6.00 to 11.00 Years Mumbai City,Pune, Bangalore, Chennai, Noida, Hyderabad, Gurugram, Kolkata, Delhi 29 Oct, 2024

What does an office assistant do

front office management

Shift Incharge

WRAP HOSPITALITY SERVICES PRIVATE LIMITED 1.00 to 5.00 Years Mumbai City 29 Oct, 2024

Shift In Charge

Previous experience in bakery operations is required
Excellent customer service, communication, and organizational skills
Ability t...
food safetyfood preparationfood qualityhygiene foodbakery operations

Financial Adviser

AES INDUSTRIAL PRIVATE LIMITED 5.00 to 10.00 Years Mumbai City,Pune, Iran, China, Bangladesh, Port Blair, Bangalore, Iraq, Chennai, Noida, Philippines, 29 Oct, 2024

Job brief We are looking for an experienced Financial Adviser to join our team and serve as a valuable intermediary between our company and clients. Your role will involve providing comprehe...
proven working experience as a financial adviser controllerplannerspecialist relevant experience

Insurance Telecaller

MPD Ventures LLP 0.00 to 3.00 Years Mumbai City 29 Oct, 2024

Loan Manager- Gold Loan

MPD Ventures LLP 1.00 to 3.00 Years Mumbai City,Pune, Chennai, Indore, Lucknow, Hyderabad, Surat 29 Oct, 2024

Multiple Vacancies Open

Responsibilities

loans against securities

Financial Systems Analyst

MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 3.00 to 7.00 Years Mumbai City,Pune, Bangalore, Noida, Chennai, Hyderabad, Gurugram, Delhi 29 Oct, 2024

Tests and validates system changes
Need to support for onshore hours during month end
Research accounting issues as they arise and provide recommendations for solutio...
procurementadvanced excelmis reportingbank reconciliationoperationstds calculationfinancial reportingtallyexcel report

Accounting Specialist

MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 3.00 to 7.00 Years Mumbai City,Pune, Bangalore, Chennai, Noida, Hyderabad, Gurugram, Delhi 29 Oct, 2024

Design Engineer

MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 8.00 Years Mumbai City,Pune, Bangalore, Chennai, Noida, Hyderabad, Gurugram, Delhi 29 Oct, 2024

Responsibilities

Design new engineering products and processes

Craft models and drawings of products using CAD

Analyze prototype data and retest if needed<...
safetyproduct designsystems thinkingreport writingcompliancemechanical engineeringstandardsproduct developmentresilienceactive listeningskillscomputational

Part time trainee

WRAP HOSPITALITY SERVICES PRIVATE LIMITED 1.00 to 5.00 Years Mumbai City 29 Oct, 2024

Part-Time Trainee Baker

Data Analyst

ARYAN TECHNOLOGY 0.00 to 4.00 Years Mumbai City,Pune, Bangalore, Kolkata, Delhi 29 Oct, 2024

time series analysis

statistical modeling

enterprise data modeling

data analysis

data integration

Test Engineer

ARYAN TECHNOLOGY 0.00 to 4.00 Years Mumbai City,Pune, Bangalore, Chennai, Kolkata 29 Oct, 2024

Demand Generation Manager

SAIKOR SECURITY TRAINING AND SERVICES PRIVATE LIMITED 18.00 to 25.00 Years Mumbai City,Pune, Bangalore, Noida, Chennai, Hyderabad, Kolkata, Gurugram, Delhi, Port Blair 29 Oct, 2024

Manager - Co-Lending and Partnerships

Mahindra & Mahindra Financial Services Limited 4.00 to 8.00 Years Mumbai City 29 Oct, 2024

Job Purpose Statement:

partnerships

client relationship management

merchant cash advance

Quality Control Manager

OVERNET TRADING PRIVATE LIMITED 24.00 to 25.00 Years Mumbai City,Vapi, Bangalore, Raipur, Hyderabad, Gurugram, Mahesana, Delhi, Vasco Da Gama, Khagaria 29 Oct, 2024

Project Engineer

MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 8.00 Years Mumbai City,Pune, Bangalore, Chennai, Noida, Hyderabad, Gurugram, Delhi 29 Oct, 2024

Prepare, schedule, coordinate, monitor, and control assigned engineering projects to ensure timely completion and quality delivery.
Monitor compliance with applica...
negotiationsite managementcivil engineeringengineeringleadershipsite executionautocadproject managementsite supervision

Marketing Manager

MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 9.00 Years Mumbai City,Pune, Bangalore, Chennai, Noida, Hyderabad, Gurugram, Delhi 29 Oct, 2024

Develop and execute marketing strategies to enhance brand awareness and promote real estate projects effectively.
Analyze market trends, competitor activities, and...
product promotionbrand awarenesscommercial marketingcommunication skillsreal estate marketing

Junior Research Assistant

IMPACT HR AND KM SOLUTIONS 0.00 to 1.00 Years Mumbai City,Pune, Nashik, Other Maharashtra, Dhule, Ahmednagar 29 Oct, 2024

research administration

Restaurant Manager

SAURASHTRA CEMENT LIMITED 15.00 to 18.00 Years Mumbai City 29 Oct, 2024

italian cuisine

restaurant management

restaurant customer service

fine dining

Bio-tech Research Associate / Scientist

NEW ERA LIFE CARE PRIVATE LIMITED 2.00 to 7.00 Years Mumbai City,Pune, Iran, Zimbabwe, Mozambique, Jaipur, Bangalore, Iraq, Chennai, Noida, Hyderabad, Ko 29 Oct, 2024

We are looking for a Biologist to join our team and conduct research and experiments to gain a better understanding about different biological organisms in nature.

Biol...
sciencebiochemical engineeringresearch analysisbioprocessingmicrobiologybiochemistryneurostimulationmicrobiological analysisbiologics

Operations Head
MARLEX PRODUCTS LIMITED 1.00 to 6.00 Years Mumbai City,Mira Bhayandar 29 Oct, 2024

Develop and implement operational strategies to enhance productivity. Monitor and evaluate operational performance metrics. Lead and mentor the operations team to ensure high performance. Coll...
team handlingteam management

EBS Apps technical
LTIMindtree Limited 10.00 to 20.00 Years Mumbai City,Pune, Bangalore, Noida, Chennai, Hyderabad, Delhi 29 Oct, 2024

LTIMindtree is hiring for Apps technical job opportunity. Exp required: 5 to 12 yrs Location: All LTI Offices Below is the JD: Oracle Module Expertise Oracle Inventory Order Management and Cu...
apioracle inventoryoracle soa suiteebswebservicesoracle order managementoracle scmr12oracle ebs

Motion Graphic Designer
Epicenter Technologies Private Limited 3.00 to 8.00 Years Mumbai City,Mira Bhayandar 29 Oct, 2024

Role: Motion Graphics designer Experience: 3 to 5 years relevant experience Education: Bachelors, Post Grad or equivalent Domain: wireframesmotion graphics2d animationmotion graphic designsocial mediapage layouttypography

Ecommerce Deputy Sales Manager
BRANDZSTORM INDIA MARKETING PRIVATE LIMITED 5.00 to 8.00 Years Mumbai City 29 Oct, 2024

Job Description Role Title: Ecommerce Deputy Sales Manager Marketplace Educational Qualification: BCOM/ BA/ NIFT, PGDM (Marketing) Department: Sales Work Experience (No. of years and Industry): 3...
ecommerce developmentecommerce

Agency Development Manager
RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 4.00 to 9.00 Years Mumbai City,Bangalore, Delhi, Ahmedabad 29 Oct, 2024

We are pleased to offer you the chance to advance your career with one of Indias top three most trusted life insurance brands, as recognized in the Brand Equity Most Trusted Brands Survey 2018. W...
agency salesinsurance sales

Agency Sales Manager
RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 1.00 to 5.00 Years Mumbai City,Bangalore, Delhi, Ahmedabad 29 Oct, 2024

Greetings from Reliance Nippon Life Insurance! We are thrilled to offer you an opportunity to elevate your career with one of Indias Top 3 Most Trusted Life Insurance Brands, as...
direct salesagency salesinsurance salesdirect channel salesagency channel

Data Engineer (Lead) - Wipro) PAN India
Wroots Global Private Limited 6.00 to 9.00 Years Mumbai City,Bangalore, Chennai, Hyderabad, Gurugram, Kolkata, Delhi 29 Oct, 2024

Immediate Joiners or 15 days Notice period is Preferred. Skills: DBT, GCP, Big Query along with rest technologies. Responsibilities
dbttoolssqldata warehousingsnowflakebuildhadoopbig datadataquery

Salesforce CPQ - Lead (Wipro)
Wroots Global Private Limited 7.00 to 12.00 Years Mumbai City,Pune, Bangalore, Noida, Chennai, Hyderabad, Kolkata, Gurugram, Delhi 29 Oct, 2024

Immediate Joiners or 30 Days Notice period is preferred.

Minimum 5 years of experience in Salesforce Sales & CPQ Cloud or any other CPQ Product salesforcelwccpq

Financial Adviser
AES INDUSTRIAL PRIVATE LIMITED 5.00 to 10.00 Years Hyderabad,Iran, China, Bangladesh, Port Blair, Bangalore, Iraq, Chennai, Noida, Philippines, Sri Lan 29 Oct, 2024

Job brief We are looking for an experienced Financial Adviser to join our team and serve as a valuable intermediary between our company and clients. Your role will involve providing comprehe...
proven working experience as a financial adviser controllerplannerspecialist relevant experience

Hiring For Billing Clerk
Latisha Interprises 0.00 to 3.00 Years Hyderabad,Nizamabad, Dehradun, Jaipur, Cuttack, Indore, United Arab Emirates, Vijayawada, Vishakhapa 29 Oct, 2024

The billing clerk will also be tasked with updating accounting records with issued invoices, new payments, customer information, etc. You should be able to multitask, deal with customer concerns ...
patient carehealthcarebillingchecking

Junior Sales Executive
Futurehook Technologies Pvt Ltd 1.00 to 3.00 Years Hyderabad,Bangalore, Chennai 29 Oct, 2024

We are seeking a dynamic Junior Product Consultant to join our field sales team in Bengaluru. This role is ideal for a self-motivated individual with a strong understanding of smart hom...
kannadatravel salesfield salesnegotiationsales

Sales Manager E-Surveillance business - PAN India
Smart Source 5.00 to 10.00 Years Hyderabad,Bangalore, Noida, Chennai, Gurugram, Kolkata, Pune, Mumbai City, Delhi 29 Oct, 2024

Sales Manager E-Surveillance business Job Location - PAN India

This is an individual contributor role in a high-performance enviro...
enterprise salescontrolsalesaccesssurveillancecctvb2b salesfirealarm

Sales Manager (Closing Manager) - Real Estate Sales
Confidential 0.00 to 4.00 Years Hyderabad,Bangalore, Mumbai City 29 Oct, 2024

Responsibilities: 1. Lead Generation & Sales Ability to utilize various sources such as online platforms, referrals, networking events, partnerships, etc. to identify potential clients intereste...
closingsreal estate salesdeals

Shipping container fabricator and welder
BHA FOODS PRIVATE LIMITED 7.00 to 12.00 Years Hyderabad,Bangalore, Other Maharashtra, Chennai, Other Tamil Nadu, Pondicherry, Thane, Pune, Other P 29 Oct, 2024

Job description The role of a Welder Fabricator is crucial in various industries, including manufacturing, construction, and automotive. This position entails a combination of skills both i...
containerengineered standardswelfare managementforklift trainingliquid penetrant testingwelding engineeringdock equipmentwelding inspectionshippingwelding metallurgywelderfabricator

Regional Marketing Manager
LEADZN PRIVATE LIMITED 10.00 to 20.00 Years Hyderabad,Zimbabwe, Mozambique, Bangalore, Afghanistan, Chennai, Noida, Gurugram, Kolkata, Pune, Mum 29 Oct, 2024

We are looking for a goal-oriented regional marketing manager to implement marketing campaigns in accordance with the regions demographics. In this role, your responsibilities will include foreca...
regional marketingmarketingsales administrationlogistics managementdistribution managementsales coordinationregional managementpublictransportation managementcoordinatormanagerrelationsexecutive

Relationship Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 5.00 to 10.00 Years Hyderabad,Bangalore, Noida, Chennai, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

Key Responsibilities:

Client Acquisition & Relationship Management: Acquire new clients in the healthcare sector and build strong relationships with k...
wholesale bankingsmehealthcarebusiness bankingworking capitalrelationship managementsme lendingcost accountant

Talent Acquisition Specialist
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 5.00 to 10.00 Years Hyderabad,Bangalore, Noida, Chennai, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

Develop and maintain job descriptions for various roles.

Identify and attract potential candidates through diverse online platforms (e.g., social media and professional netwo...
hiringselectionoffer generationinterviewingleadership skillspostingstaffingrecruitment managementcommunication skills

Marketing Data Scientist
TEAMWORK CABLES PRIVATE LIMITED 15.00 to 25.00 Years Hyderabad,Australia, Bangladesh, Anantpur, Vietnam, Srikakulam, Afghanistan, Guntur, Philippines, Ra 29 Oct, 2024

Our Mission As the worlds number 1 job site*, our mission is to help people get jobs. We strive to cultivate an inclusive and accessible workplace where all people feel comforta...
prototypeadvertising researchmarketing researchmarketing managementtrade marketinghandle diverse data engineering tasks

Design Engineer
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 8.00 Years Hyderabad,Bangalore, Chennai, Noida, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

Responsibilities

Design new engineering products and processes

Craft models and drawings of products using CAD

Analyze prototype data and retest if needed<...
safetyproduct designsystems thinkingreport writingcompliancemechanical engineeringstandardsproduct developmentresilienceactive listeningskillscomputational

Demand Generation Manager
SAIKOR SECURITY TRAINING AND SERVICES PRIVATE LIMITED 18.00 to 25.00 Years Hyderabad,Bangalore, Noida, Chennai, Kolkata, Gurugram, Pune, Mumbai City, Delhi, Port Blair 29 Oct, 2024

We are looking for a Demand Generation Manager to develop and implement strategies to generate leads and revenue for the company. You will be responsible for working closely with the sales and m...
servicetelemarketinginsurancedigitalgoodappointmentsbusinesscrmdevelopmentcommunicationcustomersalesmarketingoutboundgenerationcallslife

Field Operator
OVERNET TRADING PRIVATE LIMITED 24.00 to 25.00 Years Hyderabad,Bangalore, Raipur, Vapi, Gurugram, Mumbai City, Mahesana, Delhi, Vasco Da Gama, Khagaria 29 Oct, 2024

Field Operator I sets up, operates and troubleshoots a variety of machines and/or equipment on customer site in accordance with established procedures and guidelines. Reads and interprets blu...
marketinglabfielddataentryassistancestoreproductionwelderoperatorcategorymanagerforemanclerkassistant

Regional Marketing Manager
LEADZN PRIVATE LIMITED 10.00 to 20.00 Years Hyderabad,Zimbabwe, Mozambique, Bangalore, Afghanistan, Chennai, Noida, Gurugram, Kolkata, Pune, Mum 29 Oct, 2024

We are looking for a goal-oriented regional marketing manager to implement marketing campaigns in accordance with the regions demographics. In this role, your responsibilities will include foreca...
regional marketingmarketingsales administrationlogistics managementdistribution managementsales coordinationregional managementpublictransportation managementcoordinatormanagerrelationsexecutive

Relationship manager(MarutiSuzuki - Showroom Sales)
KALYANI MOTORS PRIVATE LIMITED 0.00 to 2.00 Years Hyderabad 29 Oct, 2024

e are looking for a dynamic and customer-focused Showroom Sales Executive to join our team. As a Showroom Sales Executive, you will be responsible for engaging with customers, understanding their...
automobile salesconsumer sales

Child Life Specialist
NEW ERA LIFE CARE PRIVATE LIMITED 11.00 to 21.00 Years Hyderabad,Bangalore, Chennai, Noida, Nellore, Gurugram, Kolkata, Pune, Mumbai City, Delhi 29 Oct, 2024

We are looking for a Child Life Specialist to join our team and help our pediatric patients have a more relaxing and effective recovery time while in our healthcare facility. Child Life Speciali...
collaborationleadershipcommunicationadvocacytherapydevelopmentpatienceemotionalservicesfamilylifeempathychildplayengaging

Loan Manager- Gold Loan
MPD Ventures LLP 1.00 to 3.00 Years Hyderabad,Chennai, Indore, Lucknow, Pune, Mumbai City, Surat 29 Oct, 2024

Multiple Vacancies Open Responsibilities: Sourcing/Acquisition of GoldloanCustomers at Customer Doorsteps Deliver Monthly targets by meeting and...
loans against securitiesbusiness developmentgold loan operationsgold loanloan operationssales

EBS Apps technical
LTIMindtree Limited 10.00 to 20.00 Years Hyderabad,Bangalore, Noida, Chennai, Pune, Mumbai City, Delhi 29 Oct, 2024

LTIMindtree is hiring for Apps technical job opportunity. Exp required: 5 to 12 yrs Location: All LTI Offices Below is the JD: Oracle Module Expertise Oracle Inventory Order Management and Cu...
apioracle inventoryoracle soa suiteebswebservicesoracle order managementoracle scmr12oracle ebs

PREV
NEXT

understanding of local language Job Openings

What does an office assistant do

Job brief We are looking for an experienced Financial Adviser to join our team and serve as a valuable intermediary between our company and clients. Your role will involve providing comprehe... proven working experience as a financial adviser controllerplannerspecialist relevant experience

Job brief We are looking for an experienced Financial Adviser to join our team and serve as a valuable intermediary between our company and clients. Your role will involve providing comprehe... proven working experience as a financial adviser controllerplannerspecialist relevant experience

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Job brief We are looking for an experienced Financial Adviser to join our team and serve as a valuable intermediary between our company and clients. Your role will involve providing comprehe...
proven working experience as a financial adviser controllerplannerspecialist relevant experience

Job brief We are looking for an experienced Financial Adviser to join our team and serve as a valuable intermediary between our company and clients. Your role will involve providing comprehe...
proven working experience as a financial adviser controllerplannerspecialist relevant experience