understanding of relevant laws jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

understanding of relevant laws Job Openings

Showing 37001 - 37050 of 59179 Jobs

Hr Recruiter - (Internship)

CONSULTBAE INDIA PRIVATE LIMITED 0.00 to 1.00 Years Chennai,Bangalore, Noida, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

Role: HR Recruiter - Internship

Location: Remote (6 days working)

Duration : 6 months

Looking for Immediate Joiners only

englishbehavioural skills

Marketing Manager

MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 9.00 Years Chennai,Bangalore, Noida, Hyderabad, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

Develop and execute marketing strategies to enhance brand awareness and promote real estate projects effectively.
Analyze market trends, competitor activities, and...
product promotionbrand awarenesscommercial marketingcommunication skillsreal estate marketing

Bio-tech Research Associate / Scientist

NEW ERA LIFE CARE PRIVATE LIMITED 2.00 to 7.00 Years Chennai,Iran, Zimbabwe, Mozambique, Jaipur, Bangalore, Iraq, Noida, Hyderabad, Kolkata, Lebanon, Gur 29 Oct, 2024

We are looking for a Biologist to join our team and conduct research and experiments to gain a better understanding about different biological organisms in nature.

Biol...
sciencebiochemical engineeringresearch analysisbioprocessingmicrobiologybiochemistryneurostimulationmicrobiological analysisbiologics

Test Automation Architect
UST Global 10.00 to 16.00 Years Chennai,Bangalore, Kochi, Noida, Hyderabad, Pune, Thiruvanananthapuram 29 Oct, 2024

Test Automation Architect Position Overview: We are seeking an experienced Test Automation Architect to design, develop, and maintain robust automation framewo...
pythonquality assurancejavaseleniumtosca

Support Engineer
NEW ERA LIFE CARE PRIVATE LIMITED 10.00 to 20.00 Years Chennai,Bangalore, Noida, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City, Delhi 29 Oct, 2024

Were expanding our Engineering Operations team and seeking a diligent Support Engineer to help us scale effectively. In this role, youll tackle production issues, address technical queries from c...
systemcivilsecurityprocurementsupportmaintenancebusinesslogisticsqualityanalystmanagerelectricalinspectorsupervisorwarehouseengineer

EBS Apps technical
LTIMindtree Limited 10.00 to 20.00 Years Chennai,Bangalore, Noida, Hyderabad, Pune, Mumbai City, Delhi 29 Oct, 2024

LTIMindtree is hiring for Apps technical job opportunity. Exp required: 5 to 12 yrs Location: All LTI Offices Below is the JD: Oracle Module Expertise Oracle Inventory Order Management and Cu...
apioracle inventoryoracle soa suiteebswebservicesoracle order managementoracle scmr12oracle ebs

Housekeeping Supervisor
NEW ERA LIFE CARE PRIVATE LIMITED 19.00 to 22.00 Years Chennai,Bangalore, Noida, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi, Port Blair 29 Oct, 2024

We are looking for a Housekeeping Supervisor to lead our team of room attendants and ensure we provide excellent customer service. Housekeeping Supervisor responsibilities include organizing emp...
oshacustomer servicefront deskguest satisfactionclean roomssafety hazardscleanlinessroom attendantsguest rooms

Java Architect
UST Global 12.00 to 22.00 Years Chennai,Kochi, Thiruvananthapuram 29 Oct, 2024

Java Architect Location: Chennai, Trivandrum,Kochi Notice: Immediate-30 Days We are seeking a highly experienced Java Architect with a proven track record in delivering large-s...
solution architecturejavasolution design

Digital Marketing Manager
Pneumatic Vacuum Elevators and Lifts-India Private Limited 3.00 to 8.00 Years Chennai 29 Oct, 2024

Job Title: Digital Marketing Manager - U.S. based Home Elevator Manufacturing company near Chennai. Job Summary - We are looking for a skilled Digital Marketing Manager to join our team - a l...
seodigital marketingcreative designinginternet researchinternet marketingonline lead generationcreative writingcreative optimization

All India Sales Manager
Pneumatic Vacuum Elevators and Lifts-India Private Limited 3.00 to 8.00 Years Chennai 29 Oct, 2024

All India Sales Manager - Home Elevators Location: near Chennai Job Summary: We are seeking an experienced All India Sales Manager to lead our sales efforts for home elevators across the count...
sales processlead generationbusiness developmentmarketing automation

Accounts & Administration Executive
ARYAN TECHNOLOGY 0.00 to 4.00 Years Chennai,Bangalore, Noida, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

Accountant Responsibilities:

Complying with all company, local, state, and federal accounting and financial regulations.

C...
tallyaccountingauditing

EWM Functional Consultant
LTIMindtree Limited 5.00 to 10.00 Years Chennai,Bangalore, Noida, Hyderabad, Kolkata, Mumbai City 29 Oct, 2024

Greetings from LTIMindtree!! We have an urgent requirement for EWM Functional Consultant Experience: 5yrs Hiring Location-Across LTIMindtree

SAP EWM Experience of working with Decen...
saphana

Assistant Manager
AES INDUSTRIAL PRIVATE LIMITED 5.00 to 10.00 Years Bangalore,China, Bangladesh, Qatar, South Africa, Port Blair, South Korea, Iraq, Sri Lanka, Chennai, 29 Oct, 2024

We are looking for a responsible Assistant Manager to help organize and run our retail stores and fill in for thewhen needed. Your job will be highly important in ensuring the sales team meets it...
assistant workmanager self-service

Development Director
NEW ERA LIFE CARE PRIVATE LIMITED 22.00 to 0.00 Years Bangalore,Chennai, Noida, Hyderabad, Kolkata, Gurugram, Pune, Dhubri, Mumbai City, Delhi 29 Oct, 2024

We are looking for a person who is as passionate and enthusiastic about our organizations mission as we are, someone with an understanding of the importance this work has in driving change in com...
marketingroidigitalservicebusinessdevelopmentoversightcustomermanagementgenerationexcellentpatientsleadprojectprofessional

Assistant Manager Finance
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 6.00 Years Bangalore,Noida, Chennai, Hyderabad, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

Revenue Accounting:

Record and monitor revenue transactions to ensure they are recognized in the correct accounting periods.

Prepare and review journal entri...
advanced exceloperationstds calculationtallypreparationtdsvoucherbillingexcel reportprocurementfinancial reporting

Office Assistant
LEADZN PRIVATE LIMITED 6.00 to 11.00 Years Bangalore,Chennai, Noida, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City, Delhi 29 Oct, 2024

We are looking for a competent Office Assistant to help with the organization and running of the daily administrative operations of the company.
What does an office assistant do
The i...
yield managementschedulingoperationsfrontofficesales coordinationfront office managementsalesdevelopmentbusinessmanagersupervisorproposalaccount

Lease Administrator
GALLAGHER AND MOHAN PRIVATE LIMITED 4.00 to 9.00 Years Bangalore,Noida, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi, Port Blair 29 Oct, 2024

Lease Administrator
What we are and what we do:- Gallagher & Mohan works exclusively within the real estate industry. Our mission is to provide financial analysis, mark...
lease administrationadministration

Business Development Executive
MEDI TRANSCARE PRIVATE LIMITED 1.00 to 6.00 Years Bangalore 29 Oct, 2024

HI, We have a vacancy for leading MNC medical devices company on Medi Transcare employent. Designation: BDE Location: Bangalore/ Bengaluru JOB Description

Mee...
sellingsalescommunicationpharmadevices

Front Desk Officer
AANVII HEARING SOLUTIONS PRIVATE LIMITED 2.00 to 7.00 Years Bangalore 29 Oct, 2024

Job Summary: The Clinical Representative will be responsible for welcoming patients and visitors, managing appointment schedules, maintaining patient files, ensuring effective communication, and ...
front deskreceptionist activitiesfront office

Field Operator
OVERNET TRADING PRIVATE LIMITED 24.00 to 25.00 Years Bangalore,Raipur, Vapi, Hyderabad, Gurugram, Mumbai City, Mahesana, Delhi, Vasco Da Gama, Khagaria 29 Oct, 2024

Field Operator I sets up, operates and troubleshoots a variety of machines and/or equipment on customer site in accordance with established procedures and guidelines. Reads and interprets blu...
marketinglabfielddataentryassistancestoreproductionwelderoperatorcategorymanagerforemanclerkassistant

Regional Marketing Manager
LEADZN PRIVATE LIMITED 10.00 to 20.00 Years Bangalore,Zimbabwe, Mozambique, Afghanistan, Chennai, Noida, Hyderabad, Gurugram, Kolkata, Pune, Mum 29 Oct, 2024

We are looking for a goal-oriented regional marketing manager to implement marketing campaigns in accordance with the regions demographics. In this role, your responsibilities will include foreca...
regional marketingmarketingsales administrationlogistics managementdistribution managementsales coordinationregional managementpublictransportation managementcoordinatormanagerrelationsexecutive

Child Life Specialist
NEW ERA LIFE CARE PRIVATE LIMITED 11.00 to 21.00 Years Bangalore,Chennai, Noida, Nellore, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City, Delhi 29 Oct, 2024

We are looking for a Child Life Specialist to join our team and help our pediatric patients have a more relaxing and effective recovery time while in our healthcare facility. Child Life Speciali...
collaborationleadershipcommunicationadvocacytherapydevelopmentpatienceemotionalservicesfamilylifeempathychildplayengaging

Demand Generation Manager
SAIKOR SECURITY TRAINING AND SERVICES PRIVATE LIMITED 18.00 to 25.00 Years Bangalore,Noida, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi, Port Blair 29 Oct, 2024

We are looking for a Demand Generation Manager to develop and implement strategies to generate leads and revenue for the company. You will be responsible for working closely with the sales and m...
servicetelemarketinginsurancedigitalgoodappointmentsbusinesscrmdevelopmentcommunicationcustomersalesmarketingoutboundgenerationcallslife

Quality Control Manager
OVERNET TRADING PRIVATE LIMITED 24.00 to 25.00 Years Bangalore,Raipur, Vapi, Hyderabad, Gurugram, Mumbai City, Mahesana, Delhi, Vasco Da Gama, Khagaria 29 Oct, 2024

We are looking for a detail-oriented quality control manager to ensure the manufacturing production lines run smoothly and generate a consistently suitable output of products that meet quality an...
salestechgeneralqualityseniorprocurementcontrolequipmentproduction headsupervisoroperatorelectricalinstrumentmanager

Business Development Manager
NEEDION SOLUTIONS PRIVATE LIMITED 1.00 to 4.00 Years Bangalore,Guntur, Rajahmundry, Chennai, Kurnool, Nellore, Hyderabad, Guntakal, Kakinada, Anantpur 29 Oct, 2024

Vacancies for Leading Insurance companies Apply for the job to get relevant call backs Roles && Responsibilities: Team Management and Development Responsible for maintaining a culture of fairn...
marketinginsurance brokingsalesagency channelagency salesagency managementbusiness developmentinsurance sales

Biomedical Technician
LEADZN PRIVATE LIMITED 10.00 to 20.00 Years Bangalore,Zimbabwe, Mozambique, Noida, Chennai, United Arab Emirates, Hyderabad, Kolkata, Gurugram, 29 Oct, 2024

We are looking for a dynamic biomedical technician to join our biomedical department. In this role, youll be in charge of overseeing the care and use of all biomedical equipment, performing machi...
biomedical engineeringhealthcarehealthcare operationsmedical equipment planningclinical engineeringcardiologybiomedicaltechnical processbiomedical electronicsnutritionistanalyst

Assistant Finance Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 3.00 to 7.00 Years Bangalore,Noida, Chennai, Hyderabad, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

Job description

Developing an understanding of the strategies that drive our growth, you will be at the forefront of how we evolve to meet our goals. We have Finance Business Part...
payrollsupply chainprocurementrisk managementcustomer developmentforecastingfinancial reportinganalytical

Project Engineer
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 8.00 Years Bangalore,Chennai, Noida, Hyderabad, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

Prepare, schedule, coordinate, monitor, and control assigned engineering projects to ensure timely completion and quality delivery.

Monitor compliance with applica...
negotiationsite managementcivil engineeringengineeringleadershipsite executionautocadproject managementsite supervision

Marketing Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 9.00 Years Bangalore,Chennai, Noida, Hyderabad, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

Develop and execute marketing strategies to enhance brand awareness and promote real estate projects effectively.

Analyze market trends, competitor activities, and...
product promotionbrand awarenesscommercial marketingcommunication skillsreal estate marketing

Bio-tech Research Associate / Scientist
NEW ERA LIFE CARE PRIVATE LIMITED 2.00 to 7.00 Years Bangalore,Iran, Zimbabwe, Mozambique, Jaipur, Iraq, Chennai, Noida, Hyderabad, Kolkata, Lebanon, Gur 29 Oct, 2024

We are looking for a Biologist to join our team and conduct research and experiments to gain a better understanding about different biological organisms in nature. Biol...
sciencebiochemical engineeringresearch analysisbioprocessingmicrobiologybiochemistryneurostimulationmicrobiological analysisbiologics

Test Automation Architect
UST Global 10.00 to 16.00 Years Bangalore,Chennai, Kochi, Noida, Hyderabad, Pune, Thiruvanananthapuram 29 Oct, 2024

Test Automation Architect Position Overview: We are seeking an experienced Test Automation Architect to design, develop, and maintain robust automation framewo...
pythonquality assurancejavaseleniumtosca

Salesforce CPQ - Lead (Wipro)
Wroots Global Private Limited 7.00 to 12.00 Years Bangalore,Noida, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

Immediate Joiners or 30 Days Notice period is preferred.

Minimum 5 years of experience in Salesforce Sales & CPQ Cloud or any other CPQ Product salesforcelwccpq

Travel Desk Executive
Panamax Infotech 3.00 to 7.00 Years Ahmedabad,Other Gujarat 29 Oct, 2024

Location : Ahmedabad Experience : 3 to 6 Years No. Of Positions : 3 Qualifications : Any Graduate Job Description 6 Days working 24/7 rotational shifts Booking Travel Arrangements: This invo...
CoordinationCustomer ServiceExpense ManagementDocumentationBooking Travel ArrangementsItinerary PlanningTravel Policy Compliance

Business Development Manager (Marketing Service Sales )
IMS people possible 2.00 to 6.00 Years Ahmedabad,Other Gujarat 29 Oct, 2024

Excellent Communication Skill Experience : 2 to 4 Years in Marketing Service Sales Market Research and Analysis: Conduct market research to identify potential business opportunities and trends....
Strategic PlanningClient Relationship ManagementNetworkingRisk ManagementSocial Media ManagementHootsuiteContent CreationExcellent Communication SkillMarket ResearchAnalysisSalesRevenue GenerationProposalPresentation DevelopmentNegotiation

Lead Generation
SetuBridge Technolabs 2.00 to 6.00 Years Ahmedabad,Other Gujarat 29 Oct, 2024

SetuBridge Technolabs is looking for a highly skilled and experienced Lead Generation Specialist to join our dynamic team. As a Lead Generation Specialist, you will play a crucial role in identify...
Microsoft Office SuiteSocial Media PlatformsMarketing ConceptsCustomer BehaviorOrganizational SkillsAnalytical MindsetPositive Attitude

Marketing Communications Executive
Triffid Marketing Private Limited 1.00 to 5.00 Years Ahmedabad,Other Gujarat 29 Oct, 2024

About Us: TRIFFID, is a global partner for all things marketing. Headquartered in India and catering to global clients, were not just a marketing agency were a brands growth champions. In a wor...
AdaptabilityExcellent Communication SkillsExperience in MarketingAdvertisingAnalytical Acumen

Property Consultant
079 spaces 0.00 to 4.00 Years Ahmedabad,Other Gujarat 29 Oct, 2024

URGENT OPENINGS FOR PROPERTY CONSULTANT WE ARE HIRING! ROLE DESCRIPTION The property consultant will be responsible for consulting clients, providing exceptional customer service, and driving s...
Customer serviceSalesStrong negotiationProblem solving abilities

React native developer
Techerudite 2.00 to 6.00 Years Ahmedabad,Other Gujarat 29 Oct, 2024

Work as part of a team to build React Native iOS / Android applications for FullStack clients. Build pixel-perfect, responsive UIs across both mobile platforms. Architect, build and maintain exc...
JavaScriptHTMLCSSUnit testingOOPS programmingREST APIs

Golang Developer - Ahmedabad
Vedlogic Solutions Pvt Ltd 3.00 to 7.00 Years Ahmedabad,Other Gujarat 29 Oct, 2024

Degree in Computer Science, Engineering, or a related field as well as prior experience as a Golang Developer You possess strong knowledge of common Goroutine and channel patterns You have exper...
dependency managementGitRESTful APIsdatabase systemstesting toolscommunication skillsGolang DeveloperGoroutineGo frameworksGo templating languagecode generation toolsteam player

Android Developer
GFL Recruitment Private Limited 3.00 to 7.00 Years Ahmedabad,Other Gujarat 29 Oct, 2024

Job Description Mobile Developer with strong Android development experience in Android studio. Requirements And Responsibilities Lead a small team of Android developers to develop our applicati...
Android developmentAndroid StudioRequirement AnalysisDesigningAndroid SDKJAVAAPIsDevelopingAndroid Enterprise applicationKotlinUI designing

Senior Cyber Security Operations Engineer
ERM 7.00 to 11.00 Years Ahmedabad,Other Gujarat 29 Oct, 2024

Reporting into the Cyber security operations team, the senior Cyber Security operations engineer plays a critical role in overseeing and driving a broad range of activities and a trustworthy, conf...
SIEMVulnerability ManagementAutomationThreat IntelligenceRisk ManagementCyber Security OperationsSOC OperationsSecurity DocumentationCompliance ActivitiesIncident Response

Cyber Security Trainer/ IT Trainer
TechDefence 3.00 to 7.00 Years Ahmedabad,Other Gujarat 29 Oct, 2024

Company Description TechDefence is an innovative and visionary IT security company based in Ahmedabad. We specialize in technical threat management, cyber security consulting, SOC service, and do...
Application SecurityNetwork SecurityMalware Analysis

Sales Executive ( Solar )
AIMHIGH HUMAN RESOURCES PRIVATE LIMITED 1.00 to 6.00 Years Ahmedabad,Navsari 29 Oct, 2024

Requirement: 1) Good Communication Skills. 2) Understanding about solar and its product. 3) have to travel out of city also....
lead generationsales

CANADIAN Project Required Highway Design Civil Engineer
IRANIAN CONSTRUCTION GROUP 7.00 to 12.00 Years Ahmedabad,Canada, Guwahati, Bilaspur, Bhubaneswar, Bangalore, Chennai, Kochi, Hyderabad, Pune, Dalho 29 Oct, 2024

Call Or Contact through WhatsApp to check on your eligibility. Document Officer Mr. Ramesh Tiwari- Eight NineZero Ze...
highway constructionhighway engineering

Drug Safety Associate
JAI AMBEY EMERGENCY SERVICES (I) PRIVATE LIMITED 2.00 to 7.00 Years Ahmedabad,Chennai, Kochi, Vishakhapatnam, Kolkata, Silchar, Tawang, Panna, Other Bihar, Other Karnat 29 Oct, 2024

Drug safety associate provides advice to case processing team in data entry of clinical trial SAEs into Argus safety database and to medical coding of adverse events and diseases according to Med...
pharmaceutical medicinemedical affairsclinical trialsdrug safetydrug accountabilitydrug regulatory affairsdrug monitoring

Hiring For Database Administrator
Latisha Interprises 0.00 to 3.00 Years Ahmedabad,Varanasi, Dehradun, Jaipur, Indore, Pune, Mumbai City, Chandigarh, Bhopal, Coimbatore 29 Oct, 2024

An Administrative Coordinator helps keep an organization running smoothly by handling all administrative tasks. They coordinate general operations, serve as a point of contact for employees and c...
javascriptjavadevopsphp

Credit Manager Auto Loans
Taggd 2.00 to 7.00 Years Ahmedabad,Indore, Ranchi, Patna 29 Oct, 2024

Hiring Credit Manager and Area Credit Manager in Auto Loans/ Vehicle Loans Domain. All India opening. Locations Ranchi, Indore, Ahmedabad, Guwahati, Andhra Pradesh, Bihar. Duties & Resp...
vehicle loanscredit controlcredit analysiscredit risk

Layout Engineer
Talish Solutions 4.00 to 9.00 Years Ahmedabad 29 Oct, 2024

We have an opening for Layout Engineer our client in Kheda. Layout Engineer (Foundry) Position Title: Layout Engineer layoutfoundrydesigninspectionengineerdrowning

Assistant Manager Supply Chain (Social) for Cotton Industry
IMPACT CONSULTANTS 5.00 to 10.00 Years Ahmedabad,Rajkot, Aurangabad, Pune 29 Oct, 2024

A leading MNC Cotton company ishiring Asst. Manager Supply Chain (Social) Key Accountabilities:

The incumbent will help in implementing social conduc...
supply chaincomplianceginnersoraganic cotton

Billing Analyst
Divya Staffing Solution 0.00 to 4.00 Years Pune,Dehradun, Kolkata, Belgaum, Manali, Vasco Da Gama, Dibrugarh, Ahmedabad, Shimla, Guwahati 24 Oct, 2024

The billing analysts responsibilities include coordinating with other departments to ensure all sales and orders are accurately billed for, setting clients up for billing, issuing invoice Billin...
billinghealthcarepatient assessmentpatient care

PREV
NEXT

understanding of relevant laws Job Openings

Accountant Responsibilities:

What does an office assistant do

Lease Administrator

Job description Developing an understanding of the strategies that drive our growth, you will be at the forefront of how we evolve to meet our goals. We have Finance Business Part... payrollsupply chainprocurementrisk managementcustomer developmentforecastingfinancial reportinganalytical

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Job description

Developing an understanding of the strategies that drive our growth, you will be at the forefront of how we evolve to meet our goals. We have Finance Business Part...
payrollsupply chainprocurementrisk managementcustomer developmentforecastingfinancial reportinganalytical