Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Provide Pre Sales support to Servion Sales, for the Cisco line of Business specific to Contact Center Technologies. Collecting requirements, understanding the overall business and expectations of the...
cisco voicesales support product portfoliobusiness requirements saleswebex presalesbusinessProvide Pre Sales support to Servion Sales, for the Cisco line of Business specific to Contact Center Technologies. Collecting requirements, understanding the overall business and expectations of the...
cisco voicesales support product portfoliobusiness requirements saleswebex presalesbusinessProvide Pre Sales support to Servion Sales, for the Cisco line of Business specific to Contact Center Technologies. Collecting requirements, understanding the overall business and expectations of the...
cisco voicesales support product portfoliobusiness requirements saleswebex presalesbusinessProvide Pre Sales support to Servion Sales, for the Cisco line of Business specific to Contact Center Technologies. Collecting requirements, understanding the overall business and expectations of the...
cisco voicesales support product portfoliobusiness requirements saleswebex presalesbusinessYoull need to have:
10.0 Year(s) To 15.0 Year(s) JD - Avaya UC Lead Engineer Experience: 10 + Years Role: Avaya L3+/ L4 support Engineer Shifts: Applicable Travel Flexibility: Yes, domestic travel may be required ba...
troubleshooting lan operatingsystems switches assetmanagement ip cms ssh ess asa nice linux avaya etw king itservices monit ingtools virtualmachines softwareservices systemprogramming itRole Designation- Associate Consultant Responsibilities- Actively aid the consulting team in different phases of the project including problem definition, effort estimation, diagnosis, sol...
requirementanalysis businessrequirements aws nice design testing icecallrec ding eff testimation productionsuppInviting applications for the role of MT, Work Force Management The Workforce Management Analyst is responsible for the daily efforts to provide a great customer and employee experie...
accounts finance accounting sales contactcenteroperations bpovoice callcenter servicelevel contactcenter customerfocus ep ting diversityinclusion cemanagement kf cemanagementCandiate should be able to work directly with Project team, customer, account teams and business units for a successfull Contact center project delivers Candiate should be able build Customer Require...
safety commissioning site inspection troubleshooting ciscounifiedcommunications datacenter socialmedia contactcenter businessunits customerrequirements unifiedcommunications etw kmonit ing messagingplatf msJOB RESPONSIBILITIES
Note: By applying to this position your application is automatically submitted to the following locations: Hyderabad, Telangana, India; Gurugram, Haryana, India Qualifications Minimum qualificatio...
taffing models business insights drive results service delivery workfo equal employment opportunity cost effective business acumen project management user experience problem solving user support consumer products* Senior Network Designer - I Bangalore Our purpose is to use the power of communications to make a better world. For each other, for our customers, for society and our communities. We need you to ...
esign support network design solution design behavioral training technical skills knowledge sharing" The engineer is primarily responsible for proactive software/firmware and patch management activities for Avaya s global customer base. As part of the release management offering ensure eligible cu...
contact centeravaya products patch managementchange management release managementincident management communication skillsThe role is a core technical position that acts as a consultant for Cisco UCCE Solutions. Requires expert level knowledge and understanding of architecture, applications, infrastructure, systems desig...
sqlwfm lanwan siprfp ivrcti eimtacSkill : Voice Analyst Years of Experience : 8-11 Years Work Location : Pune & Trivandrum Job Description SME in building and integrating IVR applications, CTI, Agent desktops, Softphones, CRM, Outboun...
apismeivrctiictpopjavajirasoapvxmlrestlinuxavayaclaimsSupports the business in decision making and customer service efforts by providing business intelligence services. Codes, tests and executes programs for ad hoc reporting and data analysis. Imports, e...
sqlpegawritinggenesyseducationxcelcodestestsaccessverintbusinessanalysisadditionreptinginterpret10.0 Year(s) To 15.0 Year(s) JD - Avaya UC Lead Engineer Experience: 10 + Years Role: Avaya L3+/ L4 support Engineer Shifts: Applicable Travel Flexibility: Yes, domestic travel may be required ba...
troubleshootinglanoperatingsystemsswitchesassetmanagementcmssshessasanicelinuxavayaetwkingitservicesmonitingtoolsvirtualmachinessoftwareservicessystemprogrammingThis position is accountable for analysis of customer conversations/interactions utilizing an advanced speech analytics solution. Responsibilities include understanding the organizations business obje...
idealanalyticsnicecomwritingscienceenglishooteurekaverintresumebusinessalignmentdivanalysisInteraction Analytics Analyst Note- Kindly Go through the JD properly before applying for the position. This position is accountable for analysis of customer conversations/interactions utili...
scienceidealanalyticsnicewritingenglishnalyticalrooteurekaverintbusinessalignmentdivanalysisDescription: The Engineer will be responsible for troubleshooting and resolution of all incidents The Engineer will be responsible for Incident management, problem management, and change management ...
sippbxctiacditilvoipcucmniceavayah323ucceauratelverintKey Skills: Avaya L1 Verint L1 Roles & Responsibilities: Monitoring DevicesManaging Desk, Email CommunicationsIncident Management ,...
avayamanagementemailverintmoniting
Would be responsible for delivery of design and delivery in Customer Services domain including - Speech and text analysis using various technology platforms - Creating queries based on business und...
designanalyticsmanagementconsultingdataanalysiscustomerservicecustomerexperienceontextbusinessanalysiscontactcenterspeechanalyticsField Details I Hire id 7882 PIMS ID 0 Business Title Consultant Operating Location Bangalore Position Type External_Worker Compensation Range From 250000 Compensation Range To 320000 Desired Experien...
operationstargetsoftskillscommunicationavayactstel
We are hiring Workforce Analyst (WFM) for our Gurgaon location- DLF Cybercity. JOB TITLE: Workforce Business Analyst, Workforce Optimization (WFM) Experience level: 2-4 yrs...
iex aspect visio analytics Shrinkage Variance Analysis Verint CALABRIO Excel Workforce Analyst Workforce Management Workforce PlanningSpeech Analyst / Interaction Analytics Analyst / Quality Analyst ( Gurgaon ) The ideal candidate will possess strong analytical skills, root-cause analysis and attention to detail. Day-to-day respon...
Business Analytics Data Science Feedback Data Analytics Contact Center Computer Science Quality Analysis Strong Analytical Skills Problem Solving Communication SkillsWould be responsible for delivery of design and delivery in Customer Services domain including - Speech and text analysis using various technology platforms - Creating queries based on business und...
analyticsdesign deliveryqueries management consultingmanagement customer experienceAGC is an Equal Opportunity Employer. We provide the opportunity to work on diverse projects to help you gain an incredible amount of demonstrated expertise quickly. Our ambition is to help you reach ...
processanalyticsmanagementjavaivrj2eearchitecturecsshtmlc++sqlautomationoiceanalysisroboticspeechsolutionbotchatexecutionbiometricdatadevelopmentproject00030979381 Chennai - Infra Solutions Engineer Apple Platforms - 150000 INR 00030979382 Chennai - Senior Engineer Mac OS Build Engineering- 150000 INR 00030979311 Chennai - SCCM - WINDOWS 7/10 Desktop...
maintenancewindowsmacavayasccmtestingengineeringinfradesktopJob Descriptions:
Job Details: We urgently require 5 candidates for WFM (work Force Management) candidates. Excellent at Excel Good at MIS, Reporting, Forecasting and Monitoring Experience in Invoice Inbound domestic ...
problemsolvingudgmentcriticalthinkingdecisionmakingJob Details: We urgently require 5 candidates for WFM (work Force Management) candidates. Excellent at Excel Good at MIS, Reporting, Forecasting and Monitoring Experience in Invoice Inbound domestic ...
problemsolvingudgmentcriticalthinkingdecisionmaking
Job Descriptions:
Job Descriptions:
© 2019 Hireejobs All Rights Reserved