closing clients jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

closing clients Job Openings

Showing 13251 - 13300 of 38392 Jobs

Ppc Head. .

Institute of Selection 10.00 to 12.00 Years Gurugram,Delhi 01 Apr, 2025

Opening for Freelance Recruiter with Talentsphere Management Services

Reema Rai 1.00 to 6.00 Years Gurugram,Delhi, Noida, Bangalore, Kochi, Chennai, Hyderabad, Kolkata, Mumbai City, Mangalore 01 Apr, 2025

Talentsphere Management Services!

fantastic opportunity

screening resumes

executive search

freelance recruitment

Academic Counsellor

Ksirius Consultants Hiring For Aimlay and IIDE 1.00 to 4.00 Years Gurugram,Delhi, Noida, Ambernath, Thane, Mumbai City, Dombivali 01 Apr, 2025

Video Editor - Advertising Agnecy

MEGMA SERVICES 2.00 to 4.00 Years Gurugram 01 Apr, 2025

ob description

Responsible for managing multiple video projects simultaneously. This includes understanding project requirements, establishing timelines and deadlines....
adobe premiere pro2d animationadobe photoshopmotion graphicsadobe after effectscameravideoadobe illustratortrackingeditor

Business Development Manager

KKD Consulting Hiring For Clients 2.00 to 7.00 Years Gurugram,Faridabad, Ghaziabad, Noida, Panchkula, Mohali, Chandigarh, Mumbai City 01 Apr, 2025

KKD IS HIRING

Job Title: Sales Manager - Agency Channel

Company Overview:

sales

outside sales

Freelance Recruiter and Intern

KKD Consulting Hiring For KKD 0.00 to 1.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida, Sonipat, Palwal, Mumbai City, Meerut 01 Apr, 2025

Job Title: Freelance Recruiter & Recruitment Intern

Location:

Job Type:

About Us:

calling

screening

Equity Dealer

Apex Services Hiring For One of the leading broking firm 1.00 to 5.00 Years Gurugram,Delhi, Noida, Jaipur, Chandigarh 01 Apr, 2025

Dear Candidate,

Greetings From APEX SERVICES

Role-

EquityDealer

share marketcross sellingthird party productsclient acquisitionequity dealer

Data Modeler Team Lead/Architect
Angel and Genie 7.00 to 10.00 Years Gurugram 01 Apr, 2025

Data Modeler Architect Position: Data Modeler Architect Experience: 8 years Location: Gurugram Department: IT/Data Architecture Reports to: Data Architecture Lead / Data Manager Position Overvie...
big dataawsdata visualizationgcpazure

Quantity Surveyor
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Guwahati 01 Apr, 2025

Also known as cost consultants, quantity surveyors ensure building projects remain within budget. They provide cost and material estimates, draw up projected budgets, and work alongside a team, ...
quality managementquantity analysisquantity surveyingquality assurancequantity estimationquality control

Marketing Executive
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Bhagalpur, Hyderabad, Pune, Patna, Guwahati 01 Apr, 2025

Marketing executives coordinate and oversee campaigns geared at promoting products, services, and causes. Marketing executives are adept at a variety of platforms, including print and social med...
marketing researchmarketing communicationmarketing managementbrand managementmarketing

Hiring For Online Marketing Executive (Work From Home Or Office Both) DELHI-NCR
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 01 Apr, 2025

Dear Candidate Greetings fromDesnor Destination Pvt Ltd ! Job Summary Idealises Internet Marketing Agency is looking for Marketing Executive to join our dynamic team and embark on a rewarding...
marketing planningdigitaldisplay advertisingmarketingfreelancingwork from homemarketing communicationpart time

Accounting Specialist
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 3.00 to 7.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 01 Apr, 2025

Check figures, postings, and documents for accuracy. Organize, secure, and maintain all files, records, cash and cash equivalents in accordance with policies and procedures. Record, store, access...
qualitystandardsbillingaccountingfinance executivementorsupervisorpayrollfinancial

Business Development Manager
ADITYA BIRLA SUN LIFE INSURANCE COMPANY LIMITED 1.00 to 2.00 Years Gurugram,Delhi, Faridabad, Ghaziabad 01 Apr, 2025

Designation:Agency Manager Education:Any Graduates Experience:Fresher with Good network / Min. 1 Yearin anyDomain Sal...
salesinsuranceagency channelbfsi sales

Business Associate
ALTSEO PRIVATE LIMITED 15.00 to 25.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

We are looking for an energetic business development associate to help drive our sales and grow the business. You will attract new clients and build solid relationships with them while maintainin...
visualizationsalesservicemanagementmarketingterminologycommunicationcustomerprojectmedicalstatementsskills

NTT DATA Virtual Drive Hedge Fund Gurgaon
NTT DATA INFORMATION PROCESSING SERVICES PRIVATE LIMITED 1.00 to 3.00 Years Gurugram 01 Apr, 2025

NTT DATA is Hiring experienced candidates for Hedge Fund Accounting domain. Location:Gurgaon Sector 48 (Candor Techspace) Work from Office Only Shift ...
reconciliationhedge fundsnav calculationinvestment banking

Business Development Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 8.00 to 12.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 01 Apr, 2025

Key Responsibilities:

Strategic Planning: Develop and execute strategic business development plans that align with company goals and target ma...
sales growthanalysismarket analysisadaptabilityadministration workmarketcommunicationstrategic planningstrategic thinkinginnovationnegotiationcontractsresearch

3D Visualizer
ED Group Pvt Ltd 1.00 to 5.00 Years Kochi,Other Kerala 01 Apr, 2025

We are hiring! Position: 3D Visualizer Experience: 1-2 years** Location: Kochi, Kerala Only apply if you are proficient using Sketchup, Lumion and D5 Render.* Key Responsibilities: Create hig...
SketchupLumionAutoCAD

E2E CNX Architect / CNX Solution Architect
Infosys Limited 4.00 to 8.00 Years Other Kerala,Thiruvananthapuram 01 Apr, 2025

Key Responsibilities: A day in the life of an Infoscion As part of the Infosys consulting team your primary role would be to lead the engagement effort of providing high quality and value adding...
AWSDevOpsGoogle Cloud PlatformKubernetesTelecomSDLCAgile MethodologiesProject ManagementTeam ManagementAgile CoachBusiness Analyst

Operation Manager
digibiz build on quality rating pvt ltd 5.00 to 9.00 Years Kozhikode,Other Kerala 01 Apr, 2025

1. Project Management: - Plan, organize, and execute construction projects from initiation to completion. - Coordinate with District managers to ensure timely delivery within budgetary constrain...
Project ManagementResource ManagementQuality AssuranceTeam Leadership

Guest Relations Executive
GREATBELL HR Consultancy Services (P) Ltd 1.00 to 5.00 Years Wayanad,Other Kerala 01 Apr, 2025

Skills: Customer Service, Hospitality Industry, Guest Relations, Front Office Operations, Front office, Aviation, Hospitality Management, Resort, Company Overview GREATBELL HR Consultancy Servic...
Customer ServiceHospitality IndustryGuest RelationsFront Office OperationsFront officeAviationHospitality Management

Urgent hiring for the post of Computer Hardware and Networking Engineer
Karnataka Information Solution 0.00 to 4.00 Years Kochi,Bangalore, Chennai, Hyderabad 01 Apr, 2025

Computer H/w & N/w / System Administration / Desktop Support Qualification : Graduate / Diploma / Under Graduates Job Types : Fres...
network administrationcomputer hardwarehardware networking

Relationship Manager
CAREER AHEAD 1.00 to 4.00 Years Delhi,Noida, Bangalore, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City 01 Apr, 2025

Dear candidate, We are hiring Sales Manager/ Relationship Manager. Experience: 1 year CTC: as per industry standards Location: Pan India
field salesgold valuationbfsi salesgold loan operationsgold loanrelationship managersales managerloan manager

Urgent |International Sales Executives (Immigration Process) Okhla , Delhi
Sharda Consultancy Services 1.00 to 6.00 Years Delhi,Noida 01 Apr, 2025

Dear Candidates, We are lookingInternational Sales Executives (Immigration outbound sales ) in Okhla ,Delhi Salary upto 50k Medical Insurance Shift Time -12 pm to 9 pm Job description
...
customer supportupsellingsalesinternational bpoprocesslead generationvoice processsales supportimmigrationinternational voicetelesales

International Lead Generation
AVA PLACEMENT SERVICES 0.00 to 3.00 Years Delhi,Ghaziabad, Noida 01 Apr, 2025

Urgent Looking for- (International Outbound Process) Job Title: International Lead Generation Executive LOCATION- NOIDA SECTOR 1/2 NEAR BY METRO 15 NOIDA BOTH AR...
international call centerinternational voice processoutbound salescustomer serviceinternational bpocustomer supportinternational sales

Business Development Manager
KKD Consulting Hiring For Clients 2.00 to 7.00 Years Delhi,Gurugram 01 Apr, 2025

Subject: Inviting Applications for the Position of Agency Development Manager - Delhi Dear Job Seeker, We are pleased to announce an exciting opportunity for a dynamic and motivated individual ...
marketingsales

French Language Expert
Wehire Talent Solutions 0.00 to 4.00 Years Delhi,Noida, Bangalore, Nellore, Hyderabad, Other Andhra Pradesh, Pondicherry, Gurugram, Pune, Mumba 01 Apr, 2025

Job Title: French Language Interpreter (Remote) Salary: Up to 11 LPA CTC (Based on interview performance and last drawn salary) We are looking...
english writingb2 certification in frenchfrench speaking

Equity Dealer
Apex Services Hiring For One of the leading broking firm 2.00 to 5.00 Years Delhi,Faridabad, Noida, Jaipur, Jodhpur, Gurugram 01 Apr, 2025

JD Relationship Manager- Dealing:- As part of the retail distribution team, the role holder is responsible to provide compliant financial advisory services to clients and...
dematnismcross sellingstock market

Urgent Hiring for Personal Loan Sales Executive
AASAANJOBS PRIVATE LIMITED Hiring For AASAANJOBS PRIVATE LIMITED 1.00 to 5.00 Years Delhi 01 Apr, 2025

A well-defined job description sets clear expectations and attracts suitable candidates. Below is a template tailored for a Loan Sales Executive role: Job T...
loan salespersonal loans

Regional sales director- Reasl estate and project sales
MEGMA SERVICES 10.00 to 20.00 Years Delhi,Noida, Gurugram 01 Apr, 2025

Leading Engineering and construction company requires Regional sales Director( Real estate) - Dehi/ Gurugram/Noida We are looking out for Regional sales director ( Real estate and Project sales)...
project salesdirector salesregional sales manager

Equity Dealer
Apex Services Hiring For One of the leading broking firm 1.00 to 5.00 Years Delhi,Noida, Jaipur, Gurugram, Chandigarh 01 Apr, 2025

Dear Candidate, Greetings From APEX SERVICES Role-EquityDealer share marketcross sellingthird party productsclient acquisitionequity dealer

Relationship Manager
Veerwal Getwork Services Private Limited 1.00 to 6.00 Years Delhi,Faridabad, Ghaziabad, Noida, Indore, Karnal, Rohtak, Bhopal 01 Apr, 2025

Dear Applicants. Greetings of the Day! We are glad to inform you about the job opening inNBFC (Housing Finanace Company).for below mentioned Job Role: Urgent...
mortgage loanshome loans

Business Development Manager
ADITYA BIRLA SUN LIFE INSURANCE COMPANY LIMITED 1.00 to 2.00 Years Delhi,Faridabad, Ghaziabad, Gurugram 01 Apr, 2025

Designation:Agency Manager Education:Any Graduates Experience:Fresher with Good network / Min. 1 Yearin anyDomain Sal...
salesinsuranceagency channelbfsi sales

Onroll Interview | Immediate Joining | Relationship Manager- Home Loan Sales
Veerwal Getwork Services Private Limited 1.00 to 6.00 Years Delhi,Faridabad, Ghaziabad, Noida, Jaipur, Indore, Gurugram, Pune 01 Apr, 2025

Dear Applicants. Greetings of the Day! We are glad to inform you about the job opening in Sr.RM | RM for below mentioned Job Role: Urgent Interview! Timing: 10.00 AM - 1.00 P...
sales processfield work

Business Associate
ALTSEO PRIVATE LIMITED 15.00 to 25.00 Years Delhi,Noida, Bangalore, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City 01 Apr, 2025

We are looking for an energetic business development associate to help drive our sales and grow the business. You will attract new clients and build solid relationships with them while maintainin...
visualizationsalesservicemanagementmarketingterminologycommunicationcustomerprojectmedicalstatementsskills

Business Development Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 8.00 to 12.00 Years Delhi,Noida, Bangalore, Chennai, Hyderabad, Gurugram, Pune, Mumbai City 01 Apr, 2025

Key Responsibilities:

Strategic Planning: Develop and execute strategic business development plans that align with company goals and target ma...
sales growthanalysismarket analysisadaptabilityadministration workmarketcommunicationstrategic planningstrategic thinkinginnovationnegotiationcontractsresearch

WordPress Web Designer
TripleDStudio 2.00 to 6.00 Years Chandigarh 01 Apr, 2025

Company Description TripleDStudio is a renowned brand in the fields of web design, development, digital marketing, and online advertisement. Founded in November 2016, the company has quickly esta...
Web DesignResponsive Web DesignGraphic DesignWordPressFrontEnd Development

Operations Manager - Immigration
IMygrate 2.00 to 6.00 Years Chandigarh 01 Apr, 2025

At IMygrate , we help individuals and families navigate the complex journey of Canadian immigration. With offices in Canada and India, we are known for our client-first approach, transparent proce...
Operations ManagementTeam ManagementCommunication SkillsProject ManagementOrganizational SkillsTechsavvy

Senior Architect
Rajdeep and Company Infrastructure Pvt Ltd 3.00 to 7.00 Years Chandigarh 01 Apr, 2025

Key Responsibilities: 1. Design and Planning: Develop architectural designs and plans for various projects including residential, commercial, and industrial structures. Conduct feasibility stud...
Technical SkillsProject ManagementCommunication

Research Fellow
Cyber Security Academy Southampton 3.00 to 7.00 Years Chandigarh 01 Apr, 2025

Palliative Care Trial Southampton Clinical Trials Unit, Faculty of Medicine Overview Southampton Clinical Trials Unit (SCTU) is seeking a highly motivated Research Fellow join the INDIGO study ...
Qualitative researchData collectionData analysisWritten communicationOral communicationGood Clinical PracticeOrganisational skillsProblemsolvingPersonBased ApproachIntervention development

Territory Sales Executive
Manu Varghese Digital 13.00 to 17.00 Years Chandigarh 01 Apr, 2025

Summary We are looking for a highly motivated Territory Sales Executive to take charge of our regional sales operations. This is a fantastic opportunity to lead our territory expansion, build a s...
B2B salescommunicationnegotiationmarketing strategies

Apprentice Trainee, Payroll
Oceaneering 0.00 to 3.00 Years Chandigarh 01 Apr, 2025

Company Profile Overview Since year 2003, Oceaneerings India Center has been an integral part of operations for Oceaneerings robust product and service offerings across the globe. This center ca...
Microsoft Office SuiteVerbalwritten communications

Sales Officer
DREAMS SOLUTIONS Fresher Chandigarh 01 Apr, 2025

SALES OFFICER FRESHER/EXPERIENCES 2.5CTC INCENTIVES LOCATION - CHANDIGARH,KHARAR,ZIRAKPUR IMMIDIATE JOINER REQUIRED INTERVIEW DATE- 20 MARCH A Sales Officer isresponsible for selli...
salesgraduates

Inside Sales Executive
THE TALENT KEEPERS 1.00 to 5.00 Years Chandigarh,Mohali, Zirakpur, Ambala 01 Apr, 2025

URGENT HIRING! Profile-Inside Sales Location-Mohali Working Days-5 Days Working Hr - 7:30PM- 4:30PM, Night Shift (CABS ARE PROVIDED) Job Description: Utili...
international voice processvoice processlead generationinside salesinternational bpo

Civil Contractor
SHARMA ENTERPRISES 2.00 to 7.00 Years Chandigarh,Dima Hasao, Kokrajhar, Bhagalpur, Saharsa, Lakhimpur, Muzzafarpur, Patna, Guwahati, Udalg 01 Apr, 2025

We are seeking for experienced and reliable, Civil Contractor who can negotiate with subcontractors on behalf of clients, apply for building permits, dispose of and recycle waste, manage personne...
building permitsconstruction supervisionproject planningcoordination skillsbudgeting skills

DSA Manager (Gold loan)
DREAMS SOLUTIONS 1.00 to 4.00 Years Chandigarh 01 Apr, 2025

We are hiring for Leading finance company - Profile- DSA Manager (Gold loan) Location - Chandigarh Min 1 years exp required in DSA Handling for any loan. graduation mandatory Local Candidate...
salesdsa management

Relationship Manager for Leading Holidays & Resorts Company
SKILLVENTORY Hiring For Holiday and Resort Company 0.00 to 4.00 Years Chandigarh,Delhi, Ahmedabad 01 Apr, 2025

Profile Description 1. Achieving stretched targets in a result-focused environment 2. Preparing pre-sales proposals for prospective clients 3. Delivering inspiring sales presentations to convert ...
b2c salesdirect salesfield salessalestimesharecold callingrelationship managersales target

Business Development Manager
KKD Consulting Hiring For Clients 2.00 to 7.00 Years Chandigarh,Mohali, Panchkula, Noida, Ghaziabad, Gurugram, Faridabad, Mumbai City 01 Apr, 2025

KKD IS HIRING Job Title: Sales Manager - Agency Channel Company Overview: Join , a leading firm committed to innovation and excellence. Were ...
salesoutside sales

Equity Dealer
Apex Services Hiring For One of the leading broking firm 1.00 to 5.00 Years Chandigarh,Jaipur, Noida, Gurugram, Delhi 01 Apr, 2025

Dear Candidate, Greetings From APEX SERVICES Role-EquityDealer share marketcross sellingthird party productsclient acquisitionequity dealer

Service Engineer
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 12.00 to 22.00 Years Chandigarh,Bangalore, Noida, Hyderabad, South Goa, Panaji, Dibrugarh, Ahmedabad, Guwahati, Shimla 01 Apr, 2025

We are searching for a detail-orientated, deadline-driven service engineer to join our growing company. The service engineers responsibilities include repairing faults, servicing equipment, creat...
service engineeringconstruction site managementtechnical engineeringengineering supportfield service engineering

Video Editing/Making Internship in Coimbatore, Erode
KRISHTEC 0.00 to 4.00 Years Coimbatore,Other Tamil Nadu 01 Apr, 2025

Selected Interns Day-to-day Responsibilities Include Edit video footage according to scripts or project requirements Collaborate with clients to understand vision and objectives Trim footage, a...
Video EditingVisual EffectsGraphicsAudio EditingMedia ManagementColor Grading

PREV
NEXT

closing clients Job Openings

About Us:

Key Responsibilities:

Key Responsibilities:

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers