create reports jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

create reports Job Openings

Showing 17501 - 17550 of 51447 Jobs

Relationship Manager

DREAMS SOLUTIONS 0.00 to 3.00 Years Indore 01 Apr, 2025

We hiring For Relationship Manager And Advisor

For -INDORE/ NOIDA/ MUMBAI

Experince-6 Month to 2 year

sales

direct marketing

demat accounts

Human Resources (HR) Internship in Indore.

Bright Future Placement Hiring For BRIGHT FUTURE PLACEMENT 0.00 to 1.00 Years Indore 01 Apr, 2025

About the internship Se...
mba freshersmba hr

Branch Operations Executive

WorkMint 0.00 to 4.00 Years Indore,Bhopal, Bhubaneswar, Jamnagar, Jaipur, Raipur, Kolkata, Jamui, Ahmedabad, Guwahati 01 Apr, 2025

WorkMint

Hiring For Banking Branch Operations Executive Job Description

This position reports to the Head of Branch Operations and is responsible fo...
back officeback-end operationsback office operationsbackend

Female Fresher Teacher in D.P.S. School
RENOVISION TECHNOLOGY 0.00 to 1.00 Years Indore,Bhopal, Nashik, Bhubaneswar, Rourkela, Cuttack, Paradeep, Kangra, Ambala, Solan 01 Apr, 2025

Objectives of this role

Foster interdisciplinary instruction according to national curriculum standards and the educational needs and abilities of students
...
contemporary literatureteaching englishmodern languagesliterary theorycomparative literaturefrench teaching

Product Manager
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 15.00 to 25.00 Years Indore,Jabalpur, Gwalior, Bhopal, Ratlam, Sagar, Ernakulam, Pala, Wayanad, Thiruvananthapuram 01 Apr, 2025

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c...
product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing

Audit Manager
M/S B NANDI 14.00 to 24.00 Years Hyderabad,Oman, Itanagar, South America, Saudi Arabia, Kuwait, Mauritius, Bangalore, Noida, Philippi 01 Apr, 2025

We are looking for an organized, analytical auditor to help us examine our current policies and procedures and help us develop strategies to improve our internal control systems. The Auditor will...
examinationdocumentationinformation processingevaluationauditory processingreportinganalyze information

Payroll Coordinator
M/S B NANDI 10.00 to 20.00 Years Hyderabad,China, Qatar, South Africa, Tambaram, Bhubaneswar, Bangalore, Jaipur, United Arab Emirates 01 Apr, 2025

We are looking for a payroll coordinator to manage all payroll activities and ensure the timely and accurate payment of employee wages. The payroll coordinator will ensure the collection of all n...
transfer pricing analysisbenefitsrecord keepingpromotionspayroll managementpaychex

Area Sales Manager
Transformatrix Global Private Limited 6.00 to 11.00 Years Hyderabad 01 Apr, 2025

Were Hiring! Area Sales Manager (Electronic Components) Were looking for an Area Sales Manager to join our Hyderabad Office. This is an excellent opportunity for those who want to grow their car...
salesbusiness developmentindustrialelectronics

Database Manager
Divya Staffing Solution 0.00 to 4.00 Years Hyderabad,Bangalore, Kochi, Chennai, Nellore, Vijayawada, Vishakhapatnam, Other Kerala, Belgaum, Coi 01 Apr, 2025

We are looking for an experienced Operations Manager to oversee daily operations and drive efficiency and productivity. The ideal candidate will have excellent leadership, organizational, and str...
data engineeringtestingsoftware testingdata analysis

Nuclear Medicine Molecular Biology
ACHIEVERS SPOT 0.00 to 1.00 Years Hyderabad,Bangalore, Chennai, Other Tamil Nadu, Vellore 01 Apr, 2025

Job Description Position: Medical Coder Medical Coding is the Fastest-growing Profession in the Healthcare Industry Today. It is a Niche Specialization and the Demand for Trained and Certified...
biomedicalbioinformaticszoologybiology

Franchise Sales Manager
MEGMA SERVICES 7.00 to 12.00 Years Hyderabad,Other Telangana, Bangalore, Chennai, Pune, Mumbai City, Ranchi 01 Apr, 2025

Leading Jewellery Brand requires Franchise sales manager- Mumbai/ Bangalore/ Hyderabad/ Telangana ,Pune, Ranchi and Chennai locations One of our client a leading jewellery brand which is also s ...
franchsie development managerfranchise sales manager

Mechanical Engineer
C Balaji Hiring For rudra 0.00 to 1.00 Years Hyderabad,Bangalore 01 Apr, 2025

Job description: We are seeking a passionate Trainee - Mechanical Engineer Fresher. Role - Graduate Engineer Trainer Experience - 0 to 6 Months Job Location - Hyderabad B. Tech ...
mechanical maintenancemechanical engineering

Regional Sales Manager-Project sales( construction chemicals)
MEGMA SERVICES 12.00 to 20.00 Years Hyderabad,Bangalore, Chennai 01 Apr, 2025

Global construction chemical brand requires Regional sales Mgr ( Project sales)- Bangalore /Chennai/Hyderabad One of our client aGlobal construction chemical MNC aa 100% subsidiary o...
project sales headconstruction chemical sales

Female Fresher School Teacher in DPS Public School
RENOVISION TECHNOLOGY 0.00 to 1.00 Years Hyderabad,Bangalore, Cuttack, Amritsar, Jalandhar, Pune, Delhi, Dalhousie, Vadodara, Guwahati 01 Apr, 2025

Key Responsibilities:

teacher trainingeducational consultingteachingschool teacherteacherclass teacher

Farm Supervisor
YOUTAG INFOTECH PRIVATE LIMITED 15.00 to 24.00 Years Hyderabad,Bangladesh, Chirang, Guwahati, Bangalore, Bhagalpur, Chennai, Nagaon, Sivasagar, Pune, Dhu 01 Apr, 2025

We are searching for a manager with good business sense to join our team. The farm managers responsibilities include monitoring staff, crops, and livestock, purchasing supplies, preparing budgets...
farm equipmentdeerfarmingfarmlandnunchuku skillshunting landbowhuntingfarmers

Structural Engineer
LEADZN PRIVATE LIMITED 10.00 to 20.00 Years Hyderabad,Zimbabwe, Mozambique, Afghanistan, Bangalore, Noida, Chennai, Gurugram, Kolkata, Pune, Mum 01 Apr, 2025

We are seeking a skilled and experienced structural engineer to join our team and take charge of overseeing our construction projects. Your primary responsibility will be to ensure the safety and...
architecturecommunicationanalyticalengineeringdesignproblemmanagementstructuralsolvingprojectcollaborateability

Mechanical Engineer
ATOVITT SERVICES PRIVATE LIMITED 4.00 to 9.00 Years Hyderabad,Ethiopia, Bangladesh, Anantpur, Bangalore, Noida, Chennai, Kolkata, Gurugram, Pune, Mumbai 01 Apr, 2025

We are looking for a creative Mechanical Engineer to work on all product stages from research and development to design and manufacture, through to installation and final commissioning.The goal i...
thermodynamicsoptimizationfluid mechanicstroubleshootingmachine designadaptabilitystructural analysisquality assurancematerial science

Quality Engineer
AES INDUSTRIAL PRIVATE LIMITED 15.00 to 23.00 Years Hyderabad,China, Iran, Other Haryana, Other Bihar, South Korea, Other Assam, Iraq, Bangalore, Philip 01 Apr, 2025

Job brief
Were currently seeking a highly skilled and experienced Quality Engineer to join our team. In this role, you will be responsible for ensuring the safety and quality of our prod...
goodqualityanalyticalsupplier qualityengineering change managementquality managementengineer

Staff Transaction Processing
YOUTAG INFOTECH PRIVATE LIMITED 15.00 to 24.00 Years Hyderabad,Kurung Kumey, Bangalore, Tarapur, Kadapa, Cachar, Pune, East Kameng, Itanagar, Other Andam 01 Apr, 2025

Join Accenture and help transform leading organizations and communities around the world. The sheer scale of our capabilities and client engagements and the way we collaborate, operate and delive...
staff retentionstaff assessmentstaff developmentstaff schedulingstaff managementstaff relationsstaff training

Urgent Opening for Frontline Sales Associate for Insurance Domain
SPECTRUM INSURANCE BROKING PRIVATE LIMITED 1.00 to 3.00 Years Hyderabad,Bangalore, Mohali, Chennai, Kolkata, Gurugram, Pune, Mumbai City, Itanagar, Other Arunacha 01 Apr, 2025

As a Front Line Sales (FLS) employee in Agency channel, you will leverage your network to recruit Financial Consultant (Agents) and coach them to sell life insurance policies and service customer...
direct salesb2b salesb2c salesinsurance salesclient servicinglife insurancebfsi saleslead generation

We are hiring for Frontline Sales Associate for Insurance Domain
SPECTRUM INSURANCE BROKING PRIVATE LIMITED 0.00 to 3.00 Years Hyderabad,Bangalore, Srikakulam, Ongole, Chennai, Vizianagaram, Guntakal, Kolkata, Mumbai City, Anan 01 Apr, 2025

Are you good at networking and training teams If yes, then this is the right job for you! As a Front Line Sales (FLS) employee in Agency channel, you will leverage your network to recruit Finan...
life insurancesalesclient servicinglead generationbfsi salesb2b salesinsurance salesb2c sales

Financial Management
M/S AASTHA LIFECARE CORPORATION PRIVATE LIMITED 11.00 to 21.00 Years Hyderabad,Bangalore, Chennai, Kolkata, Gurugram, West Siang, Bhillai, Silvassa, Port Blair, Dibrugar 01 Apr, 2025

A Financial Manager oversees an organizations financial health, creating reports, managing investments, developing financial strategies, and ensuring compliance with regulations, all while advisi...
managementaccountsbusinessstrategyreceivableanalysisaccounting

Workforce Management Consultant
DIGITALCUBE CONSULTANCY SERVICES PRIVATE LIMITED 8.00 to 10.00 Years Hyderabad,Bangalore, Noida, Chennai, Gurugram, Kolkata, Pune, Mumbai City, Delhi 01 Apr, 2025

Designation: Workforce Management Consultant Experience Required: 8 years Work Mode: WFH Key Responsibilities: kronos timekeepingkronos wfcwfmsap hrpro

Business Development Executive
CONSULTBAE INDIA PRIVATE LIMITED 2.00 to 5.00 Years Hyderabad 01 Apr, 2025

Role:Business Development Executive Exp Required:2 years Location:Hyderabad Industry Radio, TV, Media / Advertisement salesradiob2b salesretail sales

Management Representative
ALTSEO PRIVATE LIMITED 15.00 to 25.00 Years Hyderabad,Bangalore, Chennai, Bhagalpur, Kolkata, Gurugram, Mumbai City, Delhi, Anantpur, Ahmedabad 01 Apr, 2025

Managers ensure that their assigned department, store, or district is well staffed and provisioned, adheres to quality and service standards, increases revenue and market share, and helps the bus...
qualitycollaborationdecision-makingmanagementcommunicationleadershipproblemsolvingdelegationproject

Java Full Stack Developer
Live Connections 5.00 to 10.00 Years Hyderabad 01 Apr, 2025

Formulate and define system scope and objectives for assigned projects

Develop appropriate software solutions to requests for new services and functionality

Develop...
angularawsjavamicroservices

Pharmacovigilance Associate
CLIN BIOSCIENCES 0.00 to 1.00 Years Hyderabad,Bangalore, Pune, Mumbai City 01 Apr, 2025

Roles and Responsibilities

Adverse event collection and reporting: Receiving and reviewing adverse event reports fro...
argus safetyarisgdrug safety

DLP Specilaist
MNR Solutions Pvt Ltd 3.00 to 7.00 Years Hyderabad,Gurugram, Delhi 01 Apr, 2025

DLP Location-Pan India Grade-P2/P3/P4 NP-30 days Job Overview: We are seeking a skilled Data Loss Prevention (DLP) Specialist to join our I...
qradardlpseim

Plant Engineer
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 12.00 to 22.00 Years Hyderabad,Bangalore, Noida, Chennai, Nellore, Gurugram, Kolkata, Pune, Mumbai City, Delhi 01 Apr, 2025

We are looking for a Plant Manager to drive continuous improvement and optimization of all processes.
Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla...
project engineeringprocess equipmentengineering processengineeringplant engineering

Warehouse Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 9.00 Years Hyderabad,Bangalore, Chennai, Gurugram, Delhi 01 Apr, 2025

Responsibilities and Duties Preparing documents related to dispatch such as invoices, shipping-labels, picklists etc Picking products from the warehouse for each batch Getting the products packed...
transportwarehouse managementlogistics managementwarehouse clerkpacking materialslogistics freight station warehousingwarehouse managersupply chainswarehouse logistics

Automation Testing
Srijan Spectrum Pvt Ltd 8.00 to 13.00 Years Hyderabad,Bangalore, Noida, Chennai, Gurugram, Kolkata, Pune, Mumbai City, Delhi 01 Apr, 2025

Automation Engineer Exp : 9 - 15 Notice : 0 - 30 Days Location : Remote Skills : UI Automation, ETL Automation, UAT Testing Timing : 12.30 PM - 9.30 PM Must Have Lead experience ui testinguat

Hospital Manager
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 13.00 to 18.00 Years Hyderabad,Bangalore, Kochi, Chennai, Gurugram, Kolkata, Kollam, Thiruvanananthapuram, Mumbai City, D 01 Apr, 2025

We are looking for an experienced Hospital Administration Manager to run our medical facility. To be successful in this role, you should have a deep understanding of all administrative hospital ...
problemmanagementbudgetingassurancecollaborationcommunicationqualityfinancialsolving

Nurse Practitioner Opening
Divya Staffing Solution 0.00 to 2.00 Years Gwalior,Indore, Bhopal, Jabalpur, Jaipur, Navi Mumbai, Kolkata, Pune, Mumbai City, Ahmedabad 01 Apr, 2025

The clinical research associate will manage multiple aspects of the subjects welfare. You will conduct regular site visits, generate and distribute internal and external newsletters, prepare fin...
healthcarenursingpharmacovigilancepharmaceutics

Operations Manager
WorkMint 0.00 to 4.00 Years Gwalior,Indore, Bhopal, Mandideep, Pithampur, Rewa, Dewas, Chhindwara, Singrauli, Balaghat 01 Apr, 2025

WorkMint Hiring For Banking Operations Manager Job Description Provide day to day planning and tracking support to field operations to ensure efficient and effective operations. 2. Del...
back office operationsbackend operationsback office management

Associat Customer Service
DREAMS SOLUTIONS 2.00 to 4.00 Years Gwalior,Ujjain, Indore, Pithampur, Khargone, Katni, Ratlam, Seoni, Sagar, Satna 01 Apr, 2025

We Are Hiring Associat Customer Service Key Responsibilities and Tasks: Branch Operations and Administration: Manage daily operations and administration of the branch, ensuring adherence to ban...
cash transactionsservice deliveryoperationscustomer service operationsbankingbranchcash handling

Product Manager
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 15.00 to 25.00 Years Gwalior,Indore, Bhopal, Jabalpur, Ratlam, Sagar, Ernakulam, Pala, Wayanad, Thiruvananthapuram 01 Apr, 2025

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c...
product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing

Sr.Finance Manager
Confidential 10.00 to 15.00 Years Gurugram 01 Apr, 2025

We are Hiring for Senior Finance Manager - SahiBandhu FinTech Services ( The Manipal Group) About Us:- SahiBandhu is Indias leading gold loan platform backed b...
gaapbenefits realisationcash flowrisk managementfinancial analysiserpfinancial reportingstakeholder managementerp software

Purchase Manager - Sec 43, Gurgaon ( Food Industry Experience )
Alpha Pro Services Hiring For Alpha Pro Services 1.00 to 6.00 Years Gurugram 01 Apr, 2025

Position - Purchase Manager - Male Location:Sec 43, Gurgaon Job Responsibilities :- Research potential vendors. Compare and evaluate offers f...
procurementvendor managementpurchasefood

Urgent | Hiring for Admission Head for Corporate Pre school at Gurugram
HR Globe Recruitment Service 3.00 to 8.00 Years Gurugram 01 Apr, 2025

Dear Candidates, Urgent | Hiring for Admission Head for Corporate Pre school at Gurugram Salary upto 55k Interested candidates please call hr on hidden_mobile 1. Me...
parent communicationcounsellinglead generationpreschoolonline lead generation

Sr HRBP Associate -Gurugram
MEGMA SERVICES 3.00 to 6.00 Years Gurugram 01 Apr, 2025

Leading engineering and construction company requires Sr HRBP Associate - Gurugram One of our client luxury brand which is Indias leading manufacturer of premium doors, windows, wood house and t...
hr operationshrbpassociate

Freshers, Exp - Sales Associates - EV Charger Manufacturer
Avani Consulting 0.00 to 3.00 Years Gurugram 01 Apr, 2025

Greetings from Avani Consulting We are hiring for the below opportunity: Company: A leading EV charger manufacturer, revolutionizing the electric vehicle charging ecosystem. <...
sales coordinationchargerslithium-ion batteriesbattery

Data Modeler Team Lead/Architect
Angel and Genie 7.00 to 10.00 Years Gurugram 01 Apr, 2025

Data Modeler Architect Position: Data Modeler Architect Experience: 8 years Location: Gurugram Department: IT/Data Architecture Reports to: Data Architecture Lead / Data Manager Position Overvie...
big dataawsdata visualizationgcpazure

Quantity Surveyor
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Guwahati 01 Apr, 2025

Also known as cost consultants, quantity surveyors ensure building projects remain within budget. They provide cost and material estimates, draw up projected budgets, and work alongside a team, ...
quality managementquantity analysisquantity surveyingquality assurancequantity estimationquality control

Marketing Executive
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Bhagalpur, Hyderabad, Pune, Patna, Guwahati 01 Apr, 2025

Marketing executives coordinate and oversee campaigns geared at promoting products, services, and causes. Marketing executives are adept at a variety of platforms, including print and social med...
marketing researchmarketing communicationmarketing managementbrand managementmarketing

Purchasing Assistant
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 12.00 to 22.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Panaji 01 Apr, 2025

Job brief We are seeking a detail-oriented Purchasing Assistant to join our team. Your main responsibility will be to order supplies and equipment in accordance with our companys needs. This...
purchasepurchase requisitionengineeringengineering designengineering managementproject engineeringpurchase management

Hiring For Online Marketing Executive (Work From Home Or Office Both) DELHI-NCR
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 01 Apr, 2025

Dear Candidate Greetings fromDesnor Destination Pvt Ltd ! Job Summary Idealises Internet Marketing Agency is looking for Marketing Executive to join our dynamic team and embark on a rewarding...
marketing planningdigitaldisplay advertisingmarketingfreelancingwork from homemarketing communicationpart time

Head Admin
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 5.00 to 10.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 01 Apr, 2025

Main Responsibilities:

Strategic Planning:

Identify opportunities for operational efficiency and cost savings within the administrative functions.

Prepare an...
administration managementoffice operationstravel deskfacility managementfacility operationscorporate administration

Accounting Specialist
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 3.00 to 7.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 01 Apr, 2025

Check figures, postings, and documents for accuracy. Organize, secure, and maintain all files, records, cash and cash equivalents in accordance with policies and procedures. Record, store, access...
qualitystandardsbillingaccountingfinance executivementorsupervisorpayrollfinancial

Quality Assurance Engineer
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 3.00 to 8.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

The QA technician role plays an important part in our companys product development process. Our ideal candidate will be responsible for conducting tests before product launches to ensure softwar...
automation testingmanual testingprocessqa analystquality analysttest engineerqualitytestingtest managerqa manager

Chief Talent Officer
SPENTO PAPERS (INDIA) LLP 25.00 to 0.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Itanagar 01 Apr, 2025

We are looking for a Chief Talent Officer who will support our talent acquisition and development activities. You will implement regular performance evaluations and be in charge of our employees...
engagementeeosystemhrispayrolldevelopmentorganizationplanningemployeesuccessionexcellentworkforceinterpersonalstrategic

PREV
NEXT

create reports Job Openings

About the internship Se... mba freshersmba hr

Objectives of this role Foster interdisciplinary instruction according to national curriculum standards and the educational needs and abilities of students ... contemporary literatureteaching englishmodern languagesliterary theorycomparative literaturefrench teaching

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c... product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing

Job brief

Were currently seeking a highly skilled and experienced Quality Engineer to join our team. In this role, you will be responsible for ensuring the safety and quality of our prod... goodqualityanalyticalsupplier qualityengineering change managementquality managementengineer

Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla... project engineeringprocess equipmentengineering processengineeringplant engineering

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c... product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

About the internship Se...
mba freshersmba hr

Objectives of this role

Foster interdisciplinary instruction according to national curriculum standards and the educational needs and abilities of students
...
contemporary literatureteaching englishmodern languagesliterary theorycomparative literaturefrench teaching

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c...
product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing

Were currently seeking a highly skilled and experienced Quality Engineer to join our team. In this role, you will be responsible for ensuring the safety and quality of our prod...
goodqualityanalyticalsupplier qualityengineering change managementquality managementengineer

Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla...
project engineeringprocess equipmentengineering processengineeringplant engineering

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c...
product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing