data science techniques digital transformation engineering solutions technology services domain understanding jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

data science techniques digital transformation engineering solutions technology services domain understanding Job Openings

Showing 52651 - 52700 of 154145 Jobs

Functional Consultant

Jigyansa Panda Hiring For MNC 8.00 to 13.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 15 Apr, 2025

Senior Oracle Functional Consultant

Data Entry From Home All India Home Based - Online Work

VRD INFOTECH 0.00 to 1.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Chandigarh 15 Apr, 2025

Backed office Operator Offline Typing Work From Home

VRD INFOTECH 0.00 to 1.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Chandigarh 15 Apr, 2025

Hiring For Interior Site Supervisor

AASAANJOBS PRIVATE LIMITED Hiring For AASAANJOBS PRIVATE LIMITED 1.00 to 5.00 Years Gurugram,Noida 15 Apr, 2025

We Are Hiring!

Position:

Location:

project execution

site supervision

Hr Recruiter

Confidential 0.00 to 4.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 15 Apr, 2025

Hr Recruitment Partner (Work from home) .

Job Location-: callingscreening resumesrecruitment

Bim Engineer
SHARMA ENTERPRISES 3.00 to 8.00 Years Gurugram,Delhi, Noida, Bhubaneswar, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 15 Apr, 2025

We are searching for a bim modeler creates, manages, and maintains digital 3d models of buildings and structures, using bim software to support design, construction, and building lifecycle activi...
3d modelingarchicadnavisworksrevitsolibrimep design

SQL/PLSQL Developer
Angel and Genie 5.00 to 10.00 Years Gurugram 15 Apr, 2025

Position Title: SQL/PLSQL Developer Experience Level: 5 Years Location: Gurgaon Employment Type: [Full-Time] Job Summary We are seeking an experienced SQL/PLSQL Developer to join our team. The i...
sqlplsqldevelopment

Senior Project Executive
M/S B NANDI 11.00 to 19.00 Years Gurugram,Delhi, Noida, Oman, Saudi Arabia, Luxembourg, Kuwait, Bangalore, Mauritius, Chennai, Philip 15 Apr, 2025

Senior Project Manager Job Description The Senior Project Manager is responsible for leading teams to deliver projects that span across one or more business units. Will manage resources, sche...
project estimationproject managementproject management officeproject executionproject planning

Revit Architects
A9 CONSULTING 2.00 to 7.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, United Arab Emirates, Israel, Hyderabad, United Kingdom, 15 Apr, 2025

B.Arch Only ! Minimum 4 years Revit experience ! Please read before you apply:

If you have applied to our company in the past and w...
revit architecturearchitecture

Business Associate
Associated Recruitment & Management Services Pvt Ltd 10.00 to 20.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 15 Apr, 2025

Ours is a well stablished Executive Search organization and we mainly cater to the Non-IT segments. We have developed expertise in recruiting professionals for various industry segments, over la...
freelancingconsultantassociatefreelancer

Senior Relationship Manager- Government banking
Shri H R Consultants 5.00 to 10.00 Years Gurugram,Delhi, South Goa, Amritsar, North Goa, Ludhiana, Other Goa, Ahmedabad 15 Apr, 2025

Role- Senior Relationship Manager- Government Banking Location: Ahmedabad| Gurugram| Goa| Delhi| Amritsar| Ludhiana institutional salesgovernment banking

Customer Service (Voice)- International
Sharda Consultancy Services Hiring For Sharda Consultancy 0.00 to 3.00 Years Gurugram,Delhi, Noida 15 Apr, 2025

Urgent Hiring: Customer Care Executives(International) 100% Voice Night Shifts (US/UK) Excellent communication skills Location - Delhi/Gurugram/Noida Min 6 MonthsExperience Salary up to 50k...
international bpovoice processinbound salescustomer support operationscustomer serviceoutbound salessales

Digital Marketing sales process salary up To 10 Lakhs
Imaginators Try Going Beyond Hiring For Digital Marking 4.00 to 9.00 Years Gurugram 15 Apr, 2025

Job Description Hiring for Digital Marking and sales Ex in International bpo US Shift 5 days working 2 rotational off Location Gurugram required 2 years exp in sales 2 years exp in digital marki...
outboundsalesinternationalgoogle adwordscall centermeta

Asst Manager- Purchase( Building material)
MEGMA SERVICES 5.00 to 10.00 Years Gurugram 15 Apr, 2025

Leading building material and construction company requires Asst Manager -Purchase( Construction)- Gurugoan ( sector 75 A) We are looking out for Asst Manager- Purchase ( Gurugram) location We ...
procurement officerpurchase managerprocurement manager

Field Sales Executive/ Manager-Industrial products
Confidential 9.00 to 14.00 Years Gurugram,Delhi, Bangalore, Hyderabad, Vishakhapatnam, Ahmedabad 15 Apr, 2025

Job Title: Field Sales Executive/ Manager-Industrial products/ Heavy Machinery Job Location:Aurangabad/Mumbai-Kalyan/Dombivli/Haridwar/Ahmedabad/Bangalore Urban...
industrial product salesindustrialindustrial marketing

Ac Technician
Synergy Plus Business Consulting Group Hiring For Synergy Plus Business Consulting Group 1.00 to 6.00 Years Gurugram 15 Apr, 2025

We are looking for Immediate Joiner for Dharuhera location. Interested candidate may directly contact- MS. Priya hidden_mobile<...
service engineeringfield supportac technician

COMM. TECHNICIAN (EL) & JR. COMM. TECHNICIAN (EL)
Shiyali HR Services Pvt Ltd 2.00 to 6.00 Years Gurugram,Delhi, Bangalore, Chennai, Hyderabad, Kolkata, Mumbai City, Oman 15 Apr, 2025

installationlifts

Payroll & Compliance Specialist
EmpowerHire Associates Hiring For Waste Management Company 3.00 to 5.00 Years Gurugram 15 Apr, 2025

Urgently hiring male candidate for Payroll & Compliance Specialist role. He will be responsible for managing end-to-end payroll processing, ensuring accurate and timely salary disbursement, and m...
auditfinalsettlementpayroll managementstatutory compliancereconciliation

Administration Manager
ATOVITT SERVICES PRIVATE LIMITED 15.00 to 25.00 Years Gurugram,Delhi, Noida, Bangladesh, Bangalore, Chennai, Nepal, Hyderabad, Vijayawada, Kolkata, Pune, 15 Apr, 2025

We are looking for an experienced Administration Manager to supervise daily support operations of our company and plan the most efficient administrative procedures. You will lead...
operationsofficeestatemanagementproceduresequipmentchecksadministrativehumanresourcesprojectbackgroundstatementsrealfunctions

Electronics Technician
SAIKOR SECURITY TRAINING AND SERVICES PRIVATE LIMITED 15.00 to 25.00 Years Gurugram,Delhi, Noida, Iran, Pakistan, Other AndamanNicobar, Port Blair, Saudi Arabia, South Korea, 15 Apr, 2025

We are searching for a well-organized, reliable electronics technician to join our excellent company. The electronics technicians responsibilities include diagnosing and repairing electronics, re...
circuitsystemscomputerplcpreventivetechnicalsystemsupportmaintenancetoolsboardshandelectricalknowledge

Business Development Manager
Wami Outsourcing Services (OPC) Pvt Ltd 1.00 to 6.00 Years Delhi 15 Apr, 2025

Dear Jobseekers, We are hiringBusiness Development Manager 2 male and 2 female salary 28k to 40k (exp. 1 year to 2 year) Salary 40k ...
bde

Piping Engineer
RIANSHI DEVELOPERS PRIVATE LIMITED 2.00 to 7.00 Years Ghaziabad,Kurukshetra, Bhutan, Katihar, Vaishali, Rajahmundry, Karimganj, Janjgir Champa, Ireland, L 15 Apr, 2025

Job description Be part of the solution at Technip Energies and embark on a one-of-a-kind journey. You will be helping to develop cutting-edge solutions to solve real-world energy problems....
solid workspiping designmachine designequipment layoutpiping engineeringequipment modelingpiping layout

Relationship Manager
Mrprimary Hires (Opc) Private Limited 1.00 to 6.00 Years Gurugram,Delhi, Noida, Jaipur, Kolkata, Pune, Bikaner 15 Apr, 2025

We are seeking an experienced and dynamic Sales Manager Loan Against Property (LAP) to join our team in Delhi. The ideal candidate will be responsible for driving sales, managing a team, and achi...
working capitallaploan saleshome loansbusiness loan

SAP CATS Functional consultant REMOTE
Edurun Virtuoso Services Private Limited 8.00 to 13.00 Years Gurugram,Delhi, Sirsa, Sonipat, Yamunanagar, Rohtak, Other Haryana, Bangalore, Chennai, Hyderabad 15 Apr, 2025

JD for CATS: Configure and customize CATS, and integrate it with other SAP modules and external systems Create technical documentation, such as Functional documents, Test scenarios, and End-user ...
catdebuggingcats toolssap functional consultantssap

Customer Relationship Manager
Wami Outsourcing Services (OPC) Pvt Ltd 1.00 to 6.00 Years Noida 15 Apr, 2025

Hiring For Customer Relationship Manager Dear Jobseekers, We are hiringCustomer Relationship Manager. Experience-: 6 Mont...
customer relationshipcustomer service management

Academic Counselor
MNR Solutions Pvt Ltd 2.00 to 7.00 Years Noida 15 Apr, 2025

Provide academic counseling to students, guiding them in course selection, academic planning, and career paths.

Assist students with understanding academic requirements and ach...
education counselingadmission counselling

Sr. Java Developer
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 3.00 to 8.00 Years Gurugram,Delhi, Bangalore, Chennai, Hyderabad 15 Apr, 2025

Degree in computer sciences, coding, or a related field. At least 8 years experience in Java-based programming. Significant coding skills in Java, with other languages being a major plus. Excepti...
awsspring bootmicroservicesangularspringjavafull stackjava fullstack

Accounting Manager
ATOVITT SERVICES PRIVATE LIMITED 15.00 to 25.00 Years Gurugram,Delhi, Noida, Bangladesh, Bangalore, Chennai, Tirupati, Nepal, Hyderabad, Kolkata, Pune, Mu 15 Apr, 2025

We are looking for an Accounting Manager to supervise, track and evaluate day-to-day activities. Accounting Manager responsibilities include establishing financial status by developing and implem...
generalpayrollprocessingprocessledgerbalancedataaccountsfixedexternalcontrolsaccountinternalauditorssheetreconciliationscloseassets

Java Backend
Live Connections 6.00 to 11.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 15 Apr, 2025

Job Title: Java Backend Developer (GraphQL, API Development) for Cognizant
backendjavaapi

IT Recruiter ( Male)
ARS Process Solutions and Consultants Pvt Ltd 1.00 to 6.00 Years Gurugram 15 Apr, 2025

A Human Resource Market Place is looking for Talent Sourcer Location - Gurgaon Work from Office F2f Interview Immediate joiners preferred Only Male Candidate Required Exp in IT Bulk Hiring On...
technical hiringhuman resourcesit recruitmenttalent sourcertalent acquistionsearch associate

Front Office Manager
M/S AASTHA LIFECARE CORPORATION PRIVATE LIMITED 6.00 to 11.00 Years Gurugram,Samastipur, Chennai, Bellary, Kasargod, Dhanbad, Kolkata, Dibang Valley, Port Blair, Shimla 15 Apr, 2025

The hotel front office manager holds quite an important role in ensuring the smooth operation of the hotels lobby and reception area as well as being the central point of contact for guests The ...
revenue analysisoffice administrationfront officereservationshotel management

Event Coordinator
SPENTO PAPERS (INDIA) LLP 9.00 to 14.00 Years Gurugram,Delhi, Noida, Bangalore, Srikakulam, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 15 Apr, 2025

We are looking for an experienced Event coordinator to organize excellent events. You will be responsible for every aspect of an event, from choosing venues to evaluating success afterwards. An ...
customerservicemanagementpowerpointtradelogisticscorporateshowseventsaudioeventspaceplan

Part time, full time and home based Internet work Typig Work (Delhi-NCR Only)
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 15 Apr, 2025

Job description,

Dear candidates, Home based job simple typing work, No Experience require basic knowledge of c...
typingwork from homedata entrypart timehome based data entryfreelancingfresher

Tele Sales Executive
CV SOLUTIONS AND SERVICES 0.00 to 2.00 Years Gurugram,Noida 15 Apr, 2025

Job Title:Sales Executive/Tele sales Executive Location:Sector 18,Gurgaon Process Time:8:00 am to 8:00 pm Rotatio...
salesinternational salestelecallingtelecom salesbusiness developmentinternational bpotele salesinbound call centerinternational call center

Data Engineer- OBIEE/OACS
LTIMindtree Limited 3.00 to 8.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 15 Apr, 2025

Role: Data Engineer-OBIEE Location - PAN India (LTImindtree office locations) Experience 3 to 8 years Notice Period: Immediate Joiners Only

3 to 8 years of IT experience as in devel...
oasrpddata modelingobieeoac

Oracle Fusion Data Intelligence Consultant
LTIMindtree Limited 3.00 to 8.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 15 Apr, 2025

Role: Oracle Fusion Data Intelligence Consultant Experience: 3-8 Years Location: PAN India Notice Period: Immediate Joiner ...
data warehousingfdi

Senior AR Caller (US Health Care ) - Noida, Gurugram & Tikri Location
Starworth Global Solutions 1.00 to 4.00 Years Gurugram,Noida 15 Apr, 2025

Immediate Hiring: AR Caller / Senior AR Caller US Healthcare Voice Process Experience: 1 to 4 year...
physician billingrevenue cycle managementhospital billingus healthcaredenial managementar callingar calling medical billingar calling voicecms1500

Hiring For Online Marketing Executive (Work From Home Or Office Both) DELHI-NCR
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Delhi,Faridabad, Ghaziabad, Noida, Gurugram 15 Apr, 2025

Dear Candidate Greetings fromDesnor Destination Pvt Ltd ! Job Summary Idealises Internet Marketing Agency is looking for Marketing Executive to join our dynamic team and embark on a rewarding...
marketing planningdigitaldisplay advertisingmarketingfreelancingwork from homemarketing communicationpart time

Part Time Computer , Back Office Executive, Typist, Typing, Online Data Entry
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Delhi,Faridabad, Ghaziabad, Noida, Gurugram 15 Apr, 2025

Job Details, We are offering a Job. Data Entry Operator, Computer Operator, Back Office Executive, Typist Freshers and Experienced both can apply for this jobs. Po...
data entrywork from homefreelancingcomputer operatinghome basedhousewives

Membership Ambassador
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 3.00 to 5.00 Years Delhi,Noida, Bangalore, Chennai, Hyderabad, Gurugram, Pune, Mumbai City 15 Apr, 2025

Key Responsibilities:

Member Recruitment: Engage potential members and convert them into active members by explaining benefits and opportunities.

tech-savvysales coordinationteam collaborationpublic speakingcustomer servicerelationship buildingsalesmanship

JD Edwards Consultant (WIPRO-PAN INDIA)
Wroots Global Private Limited 6.00 to 10.00 Years Delhi,Bangalore, Chennai 15 Apr, 2025

JD for JD Edwards CNC Consultant Location:(Chennai/Hyderabad/Coimbatore) Open Position: 1 Key Responsibilities: technicaljdejde cnc

Oracle Transportation Management (WIPRO-PAN INDIA)
Wroots Global Private Limited 6.00 to 10.00 Years Delhi,Bangalore, Chennai, Hyderabad, Gurugram 15 Apr, 2025

IMMEDIATE JOINERS OR NOTICE PERIOD WITH 30-45 DAYS ARE REQUIRED. Key Responsibilities:

Lead the implementation and configuration of Oracle Transporta...
fusiontechnicalotmfunctionalconsulatant

Agency Head
RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 2.00 to 7.00 Years Delhi 15 Apr, 2025

||Greetings from Re;iance Nippon Life Insurance|| Dear Candidate, ! Hiring for Agency Channel and Direct Channel ! Desig...
relationshipagencydevelopmentlife insurancesalesunit

Sales Manager
RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 2.00 to 7.00 Years Delhi 15 Apr, 2025

|| Hiring - Reliance Nippon Life Insurance || Designation - ARDM (Agency Development & Recruitment Manager) & RM (Relationship Manager) CTC- 2...
agency channellife insurancedirect salesunitsales

Computer Vision Engineer
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 9.00 Years Delhi,Noida, Bangalore, Chennai, Hyderabad, Gurugram, Pune, Mumbai City 15 Apr, 2025

Your Role and Responsibilities

Design, develop, and implement computer vision algorithms and systems to solve complex problems.

Research and evaluate state-of-the-art compute...
computer visionimage processingelectrical engineeringpythonmachine learningcomputer sciencesoftware development life cycledeep learning

Head Admin
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 5.00 to 10.00 Years Delhi,Noida, Bangalore, Chennai, Hyderabad, Gurugram, Pune, Mumbai City 15 Apr, 2025

Main Responsibilities:

Strategic Planning:

Identify opportunities for operational efficiency and cost savings within the administrative functions.

Prepare an...
administration managementoffice operationstravel deskfacility managementfacility operationscorporate administration

Java Developer
HR THINKER LAB LLP 3.00 to 5.00 Years Noida 15 Apr, 2025

Java Developer Location : Noida Experience : 3 yrs. of Experience Key Skills Required: Data Structure & Algorithm

Core Jav...
mysqljunitcore javaconcurrent programmingnew relicmongodbsplunkframework

Sales Officer
Emrold Management Services Pvt Ltd 0.00 to 1.00 Years Noida 15 Apr, 2025

Lead Generation and Pr...
inbound lead generationoutbound

Backend Executive
RIANSHI DEVELOPERS PRIVATE LIMITED 10.00 to 20.00 Years Ghaziabad,Patan, Indore, Kochi, Karwar, Thiruvanananthapuram, Jharsuguda, Ferozpur, Shimla, Erode 15 Apr, 2025

Job description Proposal Development:

Analyze Request for Proposals (RFPs), Request for Quotations (RFQs), and prepare formal proposal & share with custom...
coordination skillshotel operationscustomer service skillsback office supportdocumentation practicesprocedural documentationback office managementback office operations

Creative Director
SPENTO PAPERS (INDIA) LLP 10.00 to 20.00 Years Oman,Qatar, South Africa, Ahmedabad, Chennai, Philippines, Kochi, United Arab Emirates, North Korea, 15 Apr, 2025

Creative Director We are looking for a talented and motivated creative director to lead our companys creative department. The successful candidate must possess excellent leader...
oversightprocess improvementmedicarecustomer satisfactionbusiness developmentmedicaidcustomer service

PREV
NEXT

data science techniques digital transformation engineering solutions technology services domain understanding Job Openings

Senior Project Manager Job Description The Senior Project Manager is responsible for leading teams to deliver projects that span across one or more business units. Will manage resources, sche... project estimationproject managementproject management officeproject executionproject planning

Job description Be part of the solution at Technip Energies and embark on a one-of-a-kind journey. You will be helping to develop cutting-edge solutions to solve real-world energy problems.... solid workspiping designmachine designequipment layoutpiping engineeringequipment modelingpiping layout

Job Title: Java Backend Developer (GraphQL, API Development) for Cognizant

Job description,

Dear candidates, Home based job simple typing work, No Experience require basic knowledge of c... typingwork from homedata entrypart timehome based data entryfreelancingfresher

Job Details, We are offering a Job. Data Entry Operator, Computer Operator, Back Office Executive, Typist Freshers and Experienced both can apply for this jobs. Po... data entrywork from homefreelancingcomputer operatinghome basedhousewives

Key Responsibilities:

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Senior Project Manager Job Description The Senior Project Manager is responsible for leading teams to deliver projects that span across one or more business units. Will manage resources, sche...
project estimationproject managementproject management officeproject executionproject planning

Job description Be part of the solution at Technip Energies and embark on a one-of-a-kind journey. You will be helping to develop cutting-edge solutions to solve real-world energy problems....
solid workspiping designmachine designequipment layoutpiping engineeringequipment modelingpiping layout

Dear candidates, Home based job simple typing work, No Experience require basic knowledge of c...
typingwork from homedata entrypart timehome based data entryfreelancingfresher

Job Details, We are offering a Job. Data Entry Operator, Computer Operator, Back Office Executive, Typist Freshers and Experienced both can apply for this jobs. Po...
data entrywork from homefreelancingcomputer operatinghome basedhousewives