financial records review jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

financial records review Job Openings

Showing 19651 - 19700 of 54283 Jobs

Customer Care Representative

Witbloom Training and Placement 0.00 to 1.00 Years Indore 01 Apr, 2025

Job Title

Job Location

international call centercustomer servicevoice processdomestic bposolving queriesbpograduatecustomer relationshipundergraduate

Human Resources (HR) Internship in Indore.
Bright Future Placement Hiring For BRIGHT FUTURE PLACEMENT 0.00 to 1.00 Years Indore 01 Apr, 2025

Human Resources (HR) (Indore) Start Date- 8-MARCH25 Immediately Duration 3 Months Stipend RS-5,000 / Total .APPLY
About the internship Se...
mba freshersmba hr

Customer Service Executive
Witbloom Training and Placement 0.00 to 2.00 Years Indore 01 Apr, 2025

Job Title: Customer Support Associate BPO
Process: domestic voice process
Qualification: Graduate
Salary: 20 k
Required: Excellent communication skill
Fresher and Expe...
voice processproblem solvingcustomer service

Pharmacist
Divya Staffing Solution 0.00 to 2.00 Years Indore,Bhopal, Dehradun, Jaipur, Bangalore, United Arab Emirates, Kolkata, Rishikesh, Mumbai City, D 01 Apr, 2025

Provides pharmacy services to patients/medical practitioners. Receives, compounds, fills prescriptions, dispenses pharmaceuticals, consults with clients regarding the nature and use of drugs, and...
pharmacovigilancehealthcarenursingpharma

Posting Insurance Sales Manager
Niyukti Management Consultants Hiring For Niyukti Management Consultants 3.00 to 8.00 Years Indore,Ujjain, Jabalpur, Gwalior, Bhopal, Patiala, Amritsar, Jalandhar, Ludhiana, Delhi 01 Apr, 2025

Job Description / Responsibilities:

life insurancesalesdevelopment managerdistribution manageragency development managersales officersales executive

Warehouse Supervisor
SHARMA ENTERPRISES 1.00 to 6.00 Years Indore,Gwalior, Bhopal, Bishnupur, Imphal, Shillong, Imphal West, Senapati, Churachandpur, Thoubal 01 Apr, 2025

We are looking for an experienced warehouse supervisor to manage and oversee all warehouse activities, ensure efficient processes, and maximize warehouse productivity. The warehouse supervisors r...
performancesupervisioninventorysafetymonitoringleadership

Design Manager
SHARMA ENTERPRISES 3.00 to 8.00 Years Hyderabad,Bangalore, Noida, Chennai, Gurugram, Kolkata, Pune, Mumbai City, Delhi, Guwahati 01 Apr, 2025

We are currently searching for Design Manager oversees and coordinates the creative process of design projects, ensuring designs align with business goals, client needs, and project timelines, wh...
design patternsstrategic planningtechnical documentationsupervisory skills

Audit Manager
M/S B NANDI 14.00 to 24.00 Years Hyderabad,Oman, Itanagar, South America, Saudi Arabia, Kuwait, Mauritius, Bangalore, Noida, Philippi 01 Apr, 2025

We are looking for an organized, analytical auditor to help us examine our current policies and procedures and help us develop strategies to improve our internal control systems. The Auditor will...
examinationdocumentationinformation processingevaluationauditory processingreportinganalyze information

Payroll Coordinator
M/S B NANDI 10.00 to 20.00 Years Hyderabad,China, Qatar, South Africa, Tambaram, Bhubaneswar, Bangalore, Jaipur, United Arab Emirates 01 Apr, 2025

We are looking for a payroll coordinator to manage all payroll activities and ensure the timely and accurate payment of employee wages. The payroll coordinator will ensure the collection of all n...
transfer pricing analysisbenefitsrecord keepingpromotionspayroll managementpaychex

Hr Executive
H I R E 1.00 to 6.00 Years Hyderabad 01 Apr, 2025

Greeting from H I R E! Hiring for the following Job Vacancy :HR Executive Key Responsibilities 1. Provide support for recruitment efforts, including job postings, interviewing, and onboarding....
interview schedulingemployee engagementonboardingpostingrecruitment

Hr Manager
JOB HUB HOUSE 2.00 to 7.00 Years Hyderabad 01 Apr, 2025

1. Oversee recruitment and selection processes, including sourcing, interviewing, and hiring new employees. 2. Develop and implement HR strategies, policies, and procedures. 3. Design and run e...
hr operationshr analytics

Accountant
PLACEMENT EXPERT Hiring For Congo DRC 4.00 to 9.00 Years Hyderabad,Bangalore, Chennai, Vijayawada, Gurugram, Pune, Mumbai City, Delhi 01 Apr, 2025

We have a requirement for Accountant with our client which Internet service provider in Kinshasa, Democratic Republic of the Congo. Position: Accountant englishaccounting

vacancy for Chemistry Freshers
ACHIEVERS SPOT 0.00 to 1.00 Years Hyderabad,Madurai, Chennai, Cuddalore, Erode 01 Apr, 2025

DESCRIPTION
Identify cases eligible for medical reviews and assign these to appropriate reviewers. Reach out to the client for any problems identified in the cases fo...
chemistrypharmacym.sc

Regional Sales Manager-Project sales( construction chemicals)
MEGMA SERVICES 12.00 to 20.00 Years Hyderabad,Bangalore, Chennai 01 Apr, 2025

Global construction chemical brand requires Regional sales Mgr ( Project sales)- Bangalore /Chennai/Hyderabad One of our client aGlobal construction chemical MNC aa 100% subsidiary o...
project sales headconstruction chemical sales

Female Fresher School Teacher in DPS Public School
RENOVISION TECHNOLOGY 0.00 to 1.00 Years Hyderabad,Bangalore, Cuttack, Amritsar, Jalandhar, Pune, Delhi, Dalhousie, Vadodara, Guwahati 01 Apr, 2025

Key Responsibilities:

teacher trainingeducational consultingteachingschool teacherteacherclass teacher

Male Front Office - MEHEDIPATNAM, KPHB
AURA HEARING CARE PRIVATE LIMITED 1.00 to 4.00 Years Hyderabad 01 Apr, 2025

To welcome & Assist Customer on their arrival in clinics.

Take down customers details and information. (Forms and official Templates to be filled).

Confir...
cash receiptsms officeinvoice processingbillingpetty cash

Farm Supervisor
YOUTAG INFOTECH PRIVATE LIMITED 15.00 to 24.00 Years Hyderabad,Bangladesh, Chirang, Guwahati, Bangalore, Bhagalpur, Chennai, Nagaon, Sivasagar, Pune, Dhu 01 Apr, 2025

We are searching for a manager with good business sense to join our team. The farm managers responsibilities include monitoring staff, crops, and livestock, purchasing supplies, preparing budgets...
farm equipmentdeerfarmingfarmlandnunchuku skillshunting landbowhuntingfarmers

Quality Engineer
AES INDUSTRIAL PRIVATE LIMITED 15.00 to 23.00 Years Hyderabad,China, Iran, Other Haryana, Other Bihar, South Korea, Other Assam, Iraq, Bangalore, Philip 01 Apr, 2025

Job brief
Were currently seeking a highly skilled and experienced Quality Engineer to join our team. In this role, you will be responsible for ensuring the safety and quality of our prod...
goodqualityanalyticalsupplier qualityengineering change managementquality managementengineer

Staff Transaction Processing
YOUTAG INFOTECH PRIVATE LIMITED 15.00 to 24.00 Years Hyderabad,Kurung Kumey, Bangalore, Tarapur, Kadapa, Cachar, Pune, East Kameng, Itanagar, Other Andam 01 Apr, 2025

Join Accenture and help transform leading organizations and communities around the world. The sheer scale of our capabilities and client engagements and the way we collaborate, operate and delive...
staff retentionstaff assessmentstaff developmentstaff schedulingstaff managementstaff relationsstaff training

Urgent Opening for Frontline Sales Associate for Insurance Domain
SPECTRUM INSURANCE BROKING PRIVATE LIMITED 1.00 to 3.00 Years Hyderabad,Bangalore, Mohali, Chennai, Kolkata, Gurugram, Pune, Mumbai City, Itanagar, Other Arunacha 01 Apr, 2025

As a Front Line Sales (FLS) employee in Agency channel, you will leverage your network to recruit Financial Consultant (Agents) and coach them to sell life insurance policies and service customer...
direct salesb2b salesb2c salesinsurance salesclient servicinglife insurancebfsi saleslead generation

We are hiring for Frontline Sales Associate for Insurance Domain
SPECTRUM INSURANCE BROKING PRIVATE LIMITED 0.00 to 3.00 Years Hyderabad,Bangalore, Srikakulam, Ongole, Chennai, Vizianagaram, Guntakal, Kolkata, Mumbai City, Anan 01 Apr, 2025

Are you good at networking and training teams If yes, then this is the right job for you! As a Front Line Sales (FLS) employee in Agency channel, you will leverage your network to recruit Finan...
life insurancesalesclient servicinglead generationbfsi salesb2b salesinsurance salesb2c sales

Financial Management
M/S AASTHA LIFECARE CORPORATION PRIVATE LIMITED 11.00 to 21.00 Years Hyderabad,Bangalore, Chennai, Kolkata, Gurugram, West Siang, Bhillai, Silvassa, Port Blair, Dibrugar 01 Apr, 2025

A Financial Manager oversees an organizations financial health, creating reports, managing investments, developing financial strategies, and ensuring compliance with regulations, all while advisi...
managementaccountsbusinessstrategyreceivableanalysisaccounting

Sales Engineer
Ikamate HR India Pvt Ltd 2.00 to 7.00 Years Hyderabad,Madurai, Chennai, Vijayawada, Pune, Nagpur 01 Apr, 2025

Dear Candidate! We have a job opportunity for Sales Engineer / Sr. Sales Engineer role with one of our esteemed client.We are looking for dynamic and passionate candidates for, Position : Sales ...
key account managementbusiness developmentsalesindustrial salesbusiness-to-business

Head Chef (Industrial Canteen)
MALABAR GOLD LIMITED 5.00 to 10.00 Years Hyderabad,Other Telangana 01 Apr, 2025

Greeting from Malabar!
Job Title : Head Chef ( Industrail Canteen) Experience : 6 years experience Location:Maheshwaram, Telanagana Department<...
kitchen managementmenu planninginventory managementhygienist activitiesindustrial

Pharmacovigilance Associate
CLIN BIOSCIENCES 0.00 to 1.00 Years Hyderabad,Bangalore, Pune, Mumbai City 01 Apr, 2025

Roles and Responsibilities

Adverse event collection and reporting: Receiving and reviewing adverse event reports fro...
argus safetyarisgdrug safety

DLP Specilaist
MNR Solutions Pvt Ltd 3.00 to 7.00 Years Hyderabad,Gurugram, Delhi 01 Apr, 2025

DLP Location-Pan India Grade-P2/P3/P4 NP-30 days Job Overview: We are seeking a skilled Data Loss Prevention (DLP) Specialist to join our I...
qradardlpseim

Pre Sales Executive
DIGITALCUBE CONSULTANCY SERVICES PRIVATE LIMITED 1.00 to 3.00 Years Hyderabad,Delhi 01 Apr, 2025

Designation:Pre-Sales Executive Experience Required:6month to 2years Location: presalestele sales

Full Stack Developer
LTIMindtree Limited 6.00 to 10.00 Years Hyderabad,Noida 01 Apr, 2025

Job Description Develop maintain enhance and test client systems of moderate to high complexity Execute full software development life cycle SDLC build highquality innovative and performing sof...
sdlcjavaaws

Automation Testing
Srijan Spectrum Pvt Ltd 8.00 to 13.00 Years Hyderabad,Bangalore, Noida, Chennai, Gurugram, Kolkata, Pune, Mumbai City, Delhi 01 Apr, 2025

Automation Engineer Exp : 9 - 15 Notice : 0 - 30 Days Location : Remote Skills : UI Automation, ETL Automation, UAT Testing Timing : 12.30 PM - 9.30 PM Must Have Lead experience ui testinguat

Hospital Manager
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 13.00 to 18.00 Years Hyderabad,Bangalore, Kochi, Chennai, Gurugram, Kolkata, Kollam, Thiruvanananthapuram, Mumbai City, D 01 Apr, 2025

We are looking for an experienced Hospital Administration Manager to run our medical facility. To be successful in this role, you should have a deep understanding of all administrative hospital ...
problemmanagementbudgetingassurancecollaborationcommunicationqualityfinancialsolving

Agency Development Manager
RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 0.00 to 4.00 Years Hyderabad 01 Apr, 2025

We are pleased to offer you the chance to advance your career with one of Indias top three most trusted life insurance brands, as recognized in the Brand Equity Most Trusted Brands Survey 2018. W...
insurance agency managementchannel partnersdirect salesagency sales

Requirement in Agency Development manager for Life Insurance CTc upto 5.5 lacs
ATS Infovision 3.00 to 8.00 Years Gwalior,Bhopal, Jabalpur, Solapur, Rajkot, Pune, Aurangabad, Surat, Nagpur 01 Apr, 2025

Dear Candidates, Greetings of the day! Candidate Qualifications:

Previous Sales Experience: Proven success in a sales role, prefe...
agency developmentagent recruitmentunit manager

Nurse Practitioner Opening
Divya Staffing Solution 0.00 to 2.00 Years Gwalior,Indore, Bhopal, Jabalpur, Jaipur, Navi Mumbai, Kolkata, Pune, Mumbai City, Ahmedabad 01 Apr, 2025

The clinical research associate will manage multiple aspects of the subjects welfare. You will conduct regular site visits, generate and distribute internal and external newsletters, prepare fin...
healthcarenursingpharmacovigilancepharmaceutics

Procurement Assistant
SHARMA ENTERPRISES 1.00 to 6.00 Years Gwalior,Indore, Bhopal, Ernakulam, Kochi, Bokaro, Malappuram, Kozhikode, Thrissur, Ranchi 01 Apr, 2025

We are currently searching for a Procurement Assistant supports the purchasing and supply chain processes, assisting with tasks like sourcing suppliers, preparing purchase orders, maintaining pro...
purchase operationssupplier quality assurancesourcing materialsinventory managementrecord maintenancedata analysisrecord keeping

Hiring Hiring Agency Development Manager For Life Insurance salary 4.5
Niyukti Management Consultants Hiring For Niyukti Management Consultants 5.00 to 10.00 Years Gwalior,Ujjain, Indore, Bhopal, Jabalpur, Jaipur, Jodhpur, Udaipur, Pune, Nagpur 01 Apr, 2025

Agency Development Manager Life Insurance Comp Location Salary- Upto 4lac Rimb Incentive Exp- 2-10Year sal...
salesdirect salesagency salessales development managerunit managerrelationship managersales executiveagency development manager

Posting Insurance Sales Manager
Niyukti Management Consultants Hiring For Niyukti Management Consultants 3.00 to 8.00 Years Gwalior,Ujjain, Indore, Bhopal, Jabalpur, Patiala, Amritsar, Jalandhar, Ludhiana, Delhi 01 Apr, 2025

Job Description / Responsibilities:

life insurancesalesdevelopment managerdistribution manageragency development managersales officersales executive

Warehouse Supervisor
SHARMA ENTERPRISES 1.00 to 6.00 Years Gwalior,Indore, Bhopal, Bishnupur, Imphal, Shillong, Imphal West, Senapati, Churachandpur, Thoubal 01 Apr, 2025

We are looking for an experienced warehouse supervisor to manage and oversee all warehouse activities, ensure efficient processes, and maximize warehouse productivity. The warehouse supervisors r...
performancesupervisioninventorysafetymonitoringleadership

Field Sales Executive
TRAVELMAGNET INFOTECH PRIVATE LIMITED 0.00 to 1.00 Years Gurugram,Delhi, Faridabad, Noida 01 Apr, 2025

About the Role: We are looking for energetic and customer-focused Field Sales Executives to drive merchant acquisition and promote digital payment solutions, specifically EDC (c...
field salessales

Design Manager
SHARMA ENTERPRISES 3.00 to 8.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Guwahati 01 Apr, 2025

We are currently searching for Design Manager oversees and coordinates the creative process of design projects, ensuring designs align with business goals, client needs, and project timelines, wh...
design patternsstrategic planningtechnical documentationsupervisory skills

Cluster Head - ADRV Insurance Team Handling Profile Salary Upto 14Lac
Niyukti Management Consultants 10.00 to 17.00 Years Gurugram,Delhi, Noida, Lucknow, Pune, Mumbai City 01 Apr, 2025

We are currently hiring for a key position and would like to share the updated requirements with you. Kindly review the details below: Key Specifications:
insurance agency managementinsurance saleslocation headterritory managerbranch headbranch managerchief branch managerarea manager

Sr.Finance Manager
Confidential 10.00 to 15.00 Years Gurugram 01 Apr, 2025

We are Hiring for Senior Finance Manager - SahiBandhu FinTech Services ( The Manipal Group) About Us:- SahiBandhu is Indias leading gold loan platform backed b...
gaapbenefits realisationcash flowrisk managementfinancial analysiserpfinancial reportingstakeholder managementerp software

Purchase Manager - Sec 43, Gurgaon ( Food Industry Experience )
Alpha Pro Services Hiring For Alpha Pro Services 1.00 to 6.00 Years Gurugram 01 Apr, 2025

Position - Purchase Manager - Male Location:Sec 43, Gurgaon Job Responsibilities :- Research potential vendors. Compare and evaluate offers f...
procurementvendor managementpurchasefood

Accountant
PLACEMENT EXPERT Hiring For Congo DRC 4.00 to 9.00 Years Gurugram,Delhi, Bangalore, Chennai, Hyderabad, Vijayawada, Pune, Mumbai City 01 Apr, 2025

We have a requirement for Accountant with our client which Internet service provider in Kinshasa, Democratic Republic of the Congo. Position: Accountant englishaccounting

Sr HRBP Associate -Gurugram
MEGMA SERVICES 3.00 to 6.00 Years Gurugram 01 Apr, 2025

Leading engineering and construction company requires Sr HRBP Associate - Gurugram One of our client luxury brand which is Indias leading manufacturer of premium doors, windows, wood house and t...
hr operationshrbpassociate

Lead Generation Expert
Team Vertex India Global Services Private Limited Hiring For Lead Generation Expert 1.00 to 5.00 Years Gurugram,Delhi 01 Apr, 2025

Job Title: Lead Generation Expert Location: Gurgaon Job Summary: We are looking for a proactive and results-driven Lead Generation Expert to ...
voice processinternational call centertelecom salesinternational salesinternational bpoverizonatnt

Materials Manager
SHARMA ENTERPRISES 3.00 to 8.00 Years Gurugram,Faridabad, Bhiwani, Hisar, Karnal, Kurukshetra, Panchkula, Ambala, Panipat, Kolkata 01 Apr, 2025

We are searching for a qualified materials manager to oversee our inventory and purchasing operations. If you are an experienced and competent individual with in-depth knowledge of inventory mana...
inventory managementmaterials managementmaterial procurementsourcing strategylogistics managementmanufacturingpurchase managementprocurement

Data Modeler Team Lead/Architect
Angel and Genie 7.00 to 10.00 Years Gurugram 01 Apr, 2025

Data Modeler Architect Position: Data Modeler Architect Experience: 8 years Location: Gurugram Department: IT/Data Architecture Reports to: Data Architecture Lead / Data Manager Position Overvie...
big dataawsdata visualizationgcpazure

Marketing Executive
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Bhagalpur, Hyderabad, Pune, Patna, Guwahati 01 Apr, 2025

Marketing executives coordinate and oversee campaigns geared at promoting products, services, and causes. Marketing executives are adept at a variety of platforms, including print and social med...
marketing researchmarketing communicationmarketing managementbrand managementmarketing

Purchasing Assistant
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 12.00 to 22.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Panaji 01 Apr, 2025

Job brief We are seeking a detail-oriented Purchasing Assistant to join our team. Your main responsibility will be to order supplies and equipment in accordance with our companys needs. This...
purchasepurchase requisitionengineeringengineering designengineering managementproject engineeringpurchase management

Hiring For Online Marketing Executive (Work From Home Or Office Both) DELHI-NCR
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 01 Apr, 2025

Dear Candidate Greetings fromDesnor Destination Pvt Ltd ! Job Summary Idealises Internet Marketing Agency is looking for Marketing Executive to join our dynamic team and embark on a rewarding...
marketing planningdigitaldisplay advertisingmarketingfreelancingwork from homemarketing communicationpart time

PREV
NEXT

financial records review Job Openings

About the internship Se... mba freshersmba hr

Job Title: Customer Support Associate BPO

Process: domestic voice process

Qualification: Graduate

Salary: 20 k

Required: Excellent communication skill

Fresher and Expe... voice processproblem solvingcustomer service

Job Description / Responsibilities:

DESCRIPTION

Job brief

Were currently seeking a highly skilled and experienced Quality Engineer to join our team. In this role, you will be responsible for ensuring the safety and quality of our prod... goodqualityanalyticalsupplier qualityengineering change managementquality managementengineer

Greeting from Malabar!

Job Description / Responsibilities:

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

About the internship Se...
mba freshersmba hr

Fresher and Expe...
voice processproblem solvingcustomer service

Were currently seeking a highly skilled and experienced Quality Engineer to join our team. In this role, you will be responsible for ensuring the safety and quality of our prod...
goodqualityanalyticalsupplier qualityengineering change managementquality managementengineer