inbound queries jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

inbound queries Job Openings

Showing 4301 - 4350 of 15790 Jobs

Customer Care, Voice Process with Digital Banking Exp in Blr, Pun, Hyd and Mum

WHITE HORSE MANPOWER CONSULTANCY (P) LTD Fresher Pune, BangaloreBangalore, Hyderabad, Mumbai City 25 Sep, 2025

Customer Care Executives

Digital Banking experience

digital banking

bfsi

customer care executive voice process

bank call center

banking customer support

mobile banking helpdesk

customer relationship executive

contact center banking

online banking support

Prsnl Loan Sales Telecaller

Bajaj Finance Limited Fresher Pune 25 Sep, 2025

convincing power

telecalling

communication skills

French Language Expert

IMPLEO CONSULTING Hiring For Impleo consulting Fresher Pune, BangaloreBangalore, Noida, Hyderabad, Gurugram, Kolkata, Chandigarh, Mumbai City, Delhi, Ahmed 25 Sep, 2025

PLEASE READ COMPLETELY & THEN CALL/APPLY

What we are looking for & job description:

Fre...
french to englishenglish to frenchfrench languagefrench teacherc1 in frenchfrench language expertc 2 in frenchfrench language specialistnative language french

Safety Supervisor & Safety Officer
SLN ENTERPRISES Fresher Nagpur, PunePune, Maharashtra, Indore, Odisha, Hyderabad, Madhya Pradesh, Kolkata, Bhopal, West Beng 25 Sep, 2025

Contact Person:73.03.48.90.92( Riya Sharma) Dear Candidate, Dabur India Ltd. Post: Safety Supervisor & Safety Officer Locati...
safety managementhazard analysisrisk assessmentsafety trainingincident investigationindustrial safetysafety auditsafety compliancesafety officer activities

Urgent Hiring for International
ARTECH INFOSYSTEMS PRIVATE LIMITED Fresher Mumbai City, Bangalore 25 Sep, 2025

Qualification Any graduate (mandatory) Mode of Work (WFH or WFO) - WFO Interview process Versant, CD and OPS Interview Versant Thresh...
customer supportinternational call centervoice process

Customer Relationship Manager
ICICI LOMBARD GENERAL INSURANCE CO LTD Fresher Navi Mumbai 25 Sep, 2025

Job description Roles and Responsibilities

Manage customer relationships through effective communication, empathy, and problem-solving skills.

Handle i...
customer servicebpo voiceinbound processvoice process

Telesales Executive
Skywings Advisors Private Limited Fresher Mumbai City, PunePune, Kolkata 25 Sep, 2025

Profile - Tele sales Executive Key Responsibilities: Make outbound calls to prospective customers and follow up on leads. Explain product features, benefits, ...
communication skillslife insurancetelesalestelecallingbanking salesinsuranceoutbound sales

Hiring for Customer service International Voice Process
Tech Mahindra Ltd Fresher Mumbai City 25 Sep, 2025

Customer service International Voice Process in Tech Mahindra Ltd Handle international customer calls to resolve queries and provide support. Requires excellent English communi...
international bpocustomer supportinbound processinternational voice processcommunication skillsoutbound callingoutbound sales

Customer Service Executive for Bangalore and Hyderabad with Top IT Companies
WHITE HORSE MANPOWER CONSULTANCY (P) LTD Fresher Hyderabad, Bangalore 25 Sep, 2025

We are looking for a highly motivated and customer-focused individual to join our team as a Customer Service...
inbound callscustomer carecustomer supportvoice processcommunication skillscustomer serviceemail supportcustomer handlingchat support

SAP Work Manager Developer
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Chennai, BangaloreBangalore, Noida, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi 25 Sep, 2025

SAP WorkManager: Primary Skill: SAP Work Manager Delivery Role: Sr. Developer Experience Profile: 06-10 years Candidate should have good knowledge and working experience of SAP Agentry/Work M...
spmmobile developmentjavasap work managerworkdevelopermanager

Travel Desk Executive
Bankai Infotech Fresher Ahmedabad, Gujarat 25 Sep, 2025

As a Travel Coordinator at our company, your role will involve booking travel arrangements for employees or clients, both domestic and international. You will be responsible for creating detailed ...
Travel arrangementsCustomer serviceBudget managementLogistics coordination

Sales Development Manager
RAJPUT PROTECTION SERVICE PRIVATE LIMITED Fresher Ahmedabad, AustraliaAustralia, Gwalior, Chennai, Noida, Hyderabad, Netherlands, Poland, Gurugram, Na 25 Sep, 2025

Were seeking a dynamic Sales Development Manager to lead our SDR team, focusing on achieving outbound and inbound sales targets. This role involves managing a team of 6, driving sales activities,...
sales administrationsales operationssales coordinationsales development

French Language Expert
IMPLEO CONSULTING Hiring For Impleo consulting Fresher Ahmedabad, BangaloreBangalore, Noida, Hyderabad, Gurugram, Kolkata, Pune, Chandigarh, Mumbai City, D 25 Sep, 2025

PLEASE READ COMPLETELY & THEN CALL/APPLY WORK FROM HOME { AS PER BUSINESS REQUIREMENT VOICE PROCESS } What we are looking for & job description: Fre...
french to englishenglish to frenchfrench languagefrench teacherc1 in frenchfrench language expertc 2 in frenchfrench language specialistnative language french

French Language Expert
IMPLEO CONSULTING Hiring For Impleo consulting Fresher Ahmedabad, BangaloreBangalore, Noida, Hyderabad, Gurugram, Kolkata, Pune, Chandigarh, Mumbai City, D 25 Sep, 2025

PLEASE READ COMPLETELY & THEN CALL/APPLY WORK FROM HOME { AS PER BUSINESS REQUIREMENT VOICE PROCESS } What we are looking for & job description: Fre...
french to englishenglish to frenchfrench languagefrench teacherc1 in frenchfrench language expertc 2 in frenchfrench language specialistnative language french

Walking for freshers & Exp Finance, Executive,Tax,Analyst Leading Clients
Wisdom Bridge Management Consultants Fresher Vijayawada, RajahmundryRajahmundry, Srikakulam, Vizianagaram, Ongole, Kadapa, Tirupati, Vishakhapatn 24 Sep, 2025

Preparing Tentative report by collating inputs from Business Team 2 Raising customer invoices in Excel & E-invoices in Govt. portal. 3 Coordination & follow ups with process heads for billing ...
invoice processingjournal entriesbrsfinancial reportingfinancial planninggstsales entryadvanced excelaccounts payable

Walking for freshers & Exp Finance, Executive,Tax,Analyst Leading Clients
Wisdom Bridge Management Consultants Fresher Vijayawada, RajahmundryRajahmundry, Srikakulam, Vizianagaram, Ongole, Kadapa, Tirupati, Vishakhapatn 24 Sep, 2025

Preparing Tentative report by collating inputs from Business Team 2 Raising customer invoices in Excel & E-invoices in Govt. portal. 3 Coordination & follow ups with process heads for billing ...
invoice processingjournal entriesbrsfinancial reportingfinancial planninggstsales entryadvanced excelaccounts payable

Sales Executive -Urgent Hiring
Planet Spark Fresher Vishakhapatnam, HyderabadHyderabad, Assam, Madurai, Bangalore, Arwal, Karbi Anglong, Gurugram, Mumba 24 Sep, 2025

Job Location: Gurgaon (Full-time, On-site) Candidates must be willing to relocate.
communication skillsnegotiation skillsdomestic salessalesforceinternational salessales

Backend .NET Developer
AppleTech Fresher Vadodara, Gujarat 24 Sep, 2025

As a Web Application Developer at AppleTechSoft, you will be required to have a minimum of 5 years of hands-on experience in developing web applications on the Microsoft Windows Platform and cloud...
Software DesignArchitectureREST APIOODAOPSQL ServerSQL QueriesJOINSDatabase DesignLINQDebuggingAnalytical SkillsJAVASCRIPTDOJODockerMicrosoft TechnologiesVerbal CommunicationWritten CommunicationMicrosoft Windows PlatformCloud Technolog

Sales Co-ordinator
MecPower Solutions Pvt Ltd Fresher Vadodara, Gujarat 24 Sep, 2025

As a Sales Coordinator, your primary role will be to support the sales team in enhancing their productivity and efficiency. This includes arranging appointments with customers, maintaining up-to-d...
OrganizationCustomer serviceOrganizingInterpersonal skillsPresentation skillsProblemsolvingMultitaskingSalesmarketing campaignsPrioritizingTeam playerDetailoriented

Bulk Hiring for Freshers 12th Pass
SHRI BALAJI ENTERPRISES Fresher Vadodara, SuratSurat, Ahmedabad, Bangalore, Indore, Chennai, Hyderabad, Vishakhapatnam, Pune, Mumbai 24 Sep, 2025

Job Summary
We are looking for enthusiastic and customer-focused individuals to join our BPO team as Call Cen...
negotiation skillsprocesstechnical supportbusinesscustomer serviceadaptabilityteamworkoutsourcingbpotime managementcall handlingmultitasking

Customer Support Specialist
Live Connections Fresher Mumbai City 24 Sep, 2025

Job Title: Customer Support Associate International Voice Process Location: Malad, Mumbai Experience: Graduate Fresher OR HSC Minimum 1 Year of Experience (International Voice / Domestic Voi...
voice processcustomer supportcustomer service

Tele sales associate
Hinduja Global Solutions Limited (HGS) Fresher Thane, Navi Mumbai 24 Sep, 2025

Telesales executive (Product - insurance , credit card , loans etc ) Roles and responsibilities: Sell IDFC financial products(eg- loans, credit cards, insurance . investments) to new and exis...
callingcoldinboundsalesoutbound salesprocessvoiceoutbound calling

Tele caller associate
Hinduja Global Solutions Limited (HGS) Fresher Thane, Navi Mumbai 24 Sep, 2025

Job Summary: We are seeking enthusiastic and motivated associated to promote banking products and services. This role involves building strong customer relationships, , understanding client needs...
callingcoldsalesoutboundprocessvoicetele

Customer Service Associate
Tech Mahindra Ltd Fresher Thane, Navi MumbaiNavi Mumbai, Mumbai City 24 Sep, 2025

Tech Mahindra- Hiring for Voice Process Key Responsibilities:

Voice Process

Provide Excellent customer service to clients across different time zones

Resolve custo...
cross sellingupsellingvoice processretentionoutbound callinginternational bpocustomercommunication skillsinternational voice process

SQL Developer
FYNXT Fresher Surat, Gujarat 24 Sep, 2025

Role Overview: As a skilled SQL Database Specialist, you will be responsible for designing, optimizing, and managing databases to support the business operations effectively. Your role will involv...
SQL Serverindexingquery optimizationcommunication skillsdatabase normalizationETL processescloudbased databasesbig data technologies

District Manager
MNR Solutions Pvt Ltd Fresher Surat, SurendranagarSurendranagar, Gujarat, Tamil Nadu, Chittorgarh, Rajasthan, Hosur, Mysore, Karna 24 Sep, 2025

Responsible for Sales and collection target achievement Expanding into new talukas Expanding franchisee network and increasing dealer share of wallet Ensuring marketing camp...
farmersdistrict sales managementchannel salesdealer sales

Assistant Store Manager & Sales Assistant (Retail Stores)
Jobs Territory Hiring For Virgio Fresher Surat 24 Sep, 2025

Type: Full-time | Location: Surat Compensation: In-hand 18k-35k About the Role: Were seeking an energetic Assistant Store Mana...
stock controlcustomer servicestock replenishmentstore managementstaff schedulinginventory managementstore operationsvisual merchandising

District Manager
MNR Solutions Pvt Ltd Fresher Surat, SurendranagarSurendranagar, Gujarat, Tamil Nadu, Chittorgarh, Rajasthan, Hosur, Mysore, Karna 24 Sep, 2025

Responsible for Sales and collection target achievement Expanding into new talukas Expanding franchisee network and increasing dealer share of wallet Ensuring marketing camp...
farmersdistrict sales managementchannel salesdealer sales

presales consultant
BSH TECHNOLOGIES PRIVATE LIMITED Fresher Bhubaneswar 24 Sep, 2025

Work closely with the Business Development & Sales teams to support lead qualification and opportunity conversion.

Conduct r...
crmpresentationsclientsmbsoftwaresalestoolsexcelpowerpointdemosmarketproposalsstrongmandatory.knowledgesystems.serviceslikeestimationsusing

Customer Relationship Officer
Talent Acquaintance Fresher Ranchi, GandhinagarGandhinagar, Jaipur, Jabalpur, Raipur, Gurugram, Vishakhapatnam, Delhi, Bhopal, A 24 Sep, 2025

Immediate Openings BPO International Process (Voice, Chat & Email) Location: Jaipur Sitapura, Mans...
international voice processcustomer servicecommunication skillscustomer supportvoice processquery resolutioncustomer interactionnon voice process

Customer Relationship Officer
Talent Acquaintance Fresher Raipur, JabalpurJabalpur, Bhopal, Gandhinagar, Jaipur, Gurugram, Vishakhapatnam, Ranchi, Delhi, Ahme 24 Sep, 2025

Immediate Openings BPO International Process (Voice, Chat & Email) Location: Jaipur Sitapura, Mans...
international voice processcustomer servicecommunication skillscustomer supportvoice processquery resolutioncustomer interactionnon voice process

Dot Net Developer
RAJKAMAL BARSCAN SYSTEMS PVT LTD Fresher Patna, KolkataKolkata, Bangalore, Chennai, Noida, Hyderabad, Gurugram, Pune, Mumbai City, Delhi 24 Sep, 2025

Software Developer (.NET|.NET Core) Experience: 2 Years Location: Andheri East, Mumbai and Remote ________________________________________ Key Skills

Technologies:...
mvc frameworkdesignproceduresdatabaseweb applications.net coremssqlstoredentity framework / ef corewindows applicationscustomer support / technical issue resolution.net developer

Customer Support Specialist
SATOPRADHAN PRIVATE LIMITED Fresher Amritsar 24 Sep, 2025

At Satopradhan, we are looking forCustomer Support Specialistsfor providing exceptional service and support to customers. Required Skills & Qualifications : call center operationscustomer supportcall center managementtelecallingcustomer service

Customer Support Representative
Cyitech Search Interactive Solutions Private Limited Fresher Mohali, GurugramGurugram, Mumbai City, Bangalore, Indore, Lucknow 24 Sep, 2025

Job Description Customer Support (US Process) Requirements:

Excellent communication skills (Versant score 58 mandatory).

Graduation ...
us processbponight shift

Equity Dealer(South)
Apex Services Hiring For One of the leading broking firm Fresher Mysore, GunturGuntur, Kochi, Nellore, Kozhikode, Vijayawada, Vishakhapatnam, Kakinada, Thrissur, Coi 24 Sep, 2025

Dear Candidate, Greetings From APEX SERVICES Designation- Assistant manager/Deputy manager Role- Equity Dealer brokingcross salesshare marketsecuritiesclient acquisitionequity advisorequity dealer

District Manager
MNR Solutions Pvt Ltd Fresher Mysore, HosurHosur, Karnataka, Tamil Nadu, Gujarat, Chittorgarh, Rajasthan, Surat, Surendranagar, Er 24 Sep, 2025

Responsible for Sales and collection target achievement Expanding into new talukas Expanding franchisee network and increasing dealer share of wallet Ensuring marketing camp...
farmersdistrict sales managementchannel salesdealer sales

Sales Executive -Urgent Hiring
Planet Spark Fresher Madurai, AssamAssam, Bangalore, Arwal, Hyderabad, Vishakhapatnam, Karbi Anglong, Gurugram, Mumbai Ci 24 Sep, 2025

Job Location: Gurgaon (Full-time, On-site) Candidates must be willing to relocate.
communication skillsnegotiation skillsdomestic salessalesforceinternational salessales

Equity Dealer(South)
Apex Services Hiring For One of the leading broking firm Fresher Kakinada, GunturGuntur, Vishakhapatnam, Nellore, Vijayawada, Kochi, Kozhikode, Thrissur, Mysore, Coi 24 Sep, 2025

Dear Candidate, Greetings From APEX SERVICES Designation- Assistant manager/Deputy manager Role- Equity Dealer brokingcross salesshare marketsecuritiesclient acquisitionequity advisorequity dealer

Equity Dealer(South)
Apex Services Hiring For One of the leading broking firm Fresher Kakinada, GunturGuntur, Vishakhapatnam, Nellore, Vijayawada, Kochi, Kozhikode, Thrissur, Mysore, Coi 24 Sep, 2025

Dear Candidate, Greetings From APEX SERVICES Designation- Assistant manager/Deputy manager Role- Equity Dealer brokingcross salesshare marketsecuritiesclient acquisitionequity advisorequity dealer

Software Developer (Full Stack)
EY Fresher Kochi, Kerala 24 Sep, 2025

Role Overview: At EY, youll have the opportunity to build a unique career with global scale, support, inclusive culture, and technology to help you become the best version of yourself. Your unique...
SQLMicrosoft AzureAngularETL technologyMicrosoft Azure Data ServicesAzure Data FactoryDatabricksAzure Data Lake StoreDatabase conceptsData LakeWeb APIPowerBIPowerAppsPowerAutomatePMI

Restaurant Captain
ALTSEO PRIVATE LIMITED Fresher Kochi, AnantnagAnantnag, Bangalore, Jalore, Jabalpur, Moga, Kavaratti, Hassan, Coimbatore, Tuensang 24 Sep, 2025

Job description 1. Supervise the functions of the department employees, facilities smooth operations on a daily basis. 2. Ensures clean & safe work environment for team & Customers. 3. 80...
order takingrestaurant managementsafety complianceinventory controlmenu developmentoperationsleadership skillsoperations managementorder accuracy

Application Sales Jodhpur (IVD)
ACCUREX BIOMEDICAL PRIVATE LIMITED Fresher Jodhpur, Rajasthan 24 Sep, 2025

As an Application Sales Specialist at Accurex Biomedical in Jodhpur, you will be responsible for providing clinical application support and driving sales in the IVD domain. Your role will involve...
Application SupportSalesMarket IntelligenceDiagnostic InstrumentsCustomer Queries

Farmer Success Associate
Kheyti Fresher Gumla, Jharkhand 24 Sep, 2025

Role Overview: As a Farmer Success Associate at Kheyti, you will have the opportunity to work with smallholder farmers in India to help them battle climate change. Your main responsibilities will ...
AgricultureHorticultureAgronomy

Customer Relationship Officer
Talent Acquaintance Fresher Ranchi, GurugramGurugram, Gandhinagar, Jaipur, Jabalpur, Raipur, Vishakhapatnam, Delhi, Bhopal, Ahme 24 Sep, 2025

Immediate Openings BPO International Process (Voice, Chat & Email) Location: Jaipur Sitapura, Mans...
international voice processcustomer servicecommunication skillscustomer supportvoice processquery resolutioncustomer interactionnon voice process

Travel Consultant (GDS)
Elevate X solutions Fresher Jaipur 24 Sep, 2025

job title: travel consultant (gds) location: jaipur, india experience required: minimum 2 years (amadeus gds mandatory) education: graduate / undergraduate working days: 5.5 days per week shift t...
international call centertravel desktravel managementinternational bpo

Customer Relationship Officer
Talent Acquaintance Fresher Jaipur, DelhiDelhi, Gandhinagar, Jabalpur, Raipur, Gurugram, Vishakhapatnam, Ranchi, Bhopal, Ahmedab 24 Sep, 2025

Immediate Openings BPO International Process (Voice, Chat & Email) Location: Jaipur Sitapura, Mans...
international voice processcustomer servicecommunication skillscustomer supportvoice processquery resolutioncustomer interactionnon voice process

Field Sales Executive ( Relationship Manager)
SAPIENCE STAFFING & SERVICES PVT LTD Fresher Jaipur, DelhiDelhi, Ghaziabad, Gurugram 24 Sep, 2025

Position Overview We are seeking a dynamic and results-driven Field Sales Executive (Relationship Manager) to join our team. This role is pivotal in driving our business grow...
business loansecured financingbusiness loansmortgage loanmortgage loanslaphousing loanhousing finance

Lead - Post Sales
Livspace Fresher Jaipur, Rajasthan 24 Sep, 2025

Role Overview: As a Lead-Post Sales at Livspace, your primary responsibility is to handle customer complaints and reconcile them according to Livspaces warranty policy. Your role plays a crucial p...
ModularHardwarePresentation SkillsInterpersonal SkillsAnalytical SkillsCustomer SatisfactionInterior ProductsCustomTechnical ExpertiseInstallation ProcessMaterials SpecificationsVerbal ArticulationWritten Communication SkillsProblemSolving Sk

Customer Service Executive
HARJAI COMPUTERS PRIVATE LIMITED Fresher Jaipur, BangaloreBangalore, Pune, Ahmedabad 24 Sep, 2025

Jobtype : Work from Office JobTitle: Customer Support Officer Location: Jaipur , Bangalore , Pune , Ahmedabad customer satisfactioninboundoutboundvoice processblended process

French Language Expert
IMPLEO CONSULTING Hiring For Impleo consulting Fresher Ahmedabad, GurugramGurugram, Mumbai City, Bangalore, Noida, Hyderabad, Kolkata, Pune, Chandigarh, De 24 Sep, 2025

PLEASE READ COMPLETELY & THEN CALL/APPLY WORK FROM HOME { AS PER BUSINESS REQUIREMENT VOICE PROCESS } What we are looking for & job description: Fre...
french to englishenglish to frenchfrench languagefrench teacherc1 in frenchfrench language expertc 2 in frenchfrench language specialistnative language french

PREV
NEXT

inbound queries Job Openings

Job description Roles and Responsibilities Manage customer relationships through effective communication, empathy, and problem-solving skills. Handle i... customer servicebpo voiceinbound processvoice process

Job Summary

Position Overview We are seeking a dynamic and results-driven Field Sales Executive (Relationship Manager) to join our team. This role is pivotal in driving our business grow... business loansecured financingbusiness loansmortgage loanmortgage loanslaphousing loanhousing finance

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Job description Roles and Responsibilities

Manage customer relationships through effective communication, empathy, and problem-solving skills.

Handle i...
customer servicebpo voiceinbound processvoice process

Position Overview We are seeking a dynamic and results-driven Field Sales Executive (Relationship Manager) to join our team. This role is pivotal in driving our business grow...
business loansecured financingbusiness loansmortgage loanmortgage loanslaphousing loanhousing finance