integrated campaign execution jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

integrated campaign execution Job Openings

Showing 7601 - 7650 of 17470 Jobs

AI Developer

Wipro Technologies Ltd 1.00 to 5.00 Years Hyderabad/ Secunderabad (Telangana) 22 Apr, 2025

Wipro Limited Wipro Limited (NYSE: WIT, BSE: 507685, NSE: WIPRO) is a leading technology services and consulting company focused on building innovative solutions that address clients...

software development life cycle requirement analysis quality assurance coding and debugging customer interaction continuous integration test cases usability software validation

Technology Architect - L1

Wipro Technologies Ltd 5.00 to 8.00 Years Bengaluru/ Bangalore (Karnataka) 22 Apr, 2025

Wipro Limited (NYSE: WIT, BSE: 507685, NSE: WIPRO) is a leading technology services and consulting company focused on building innovative solutions that address clients most complex...

enterprise networking project management system integration problem solving communication skillsinformation technology system software software integration

Automation Engineer - L3

Wipro Technologies Ltd 3.00 to 5.00 Years Bengaluru/ Bangalore (Karnataka) 22 Apr, 2025

Wipro Limited (NYSE: WIT, BSE: 507685, NSE: WIPRO) is a leading technology services and consulting company focused on building innovative solutions that address cli...

automation testing software development project management agile methodologies problem resolution automation framework test automation performance testing test cases database testing tools software validation database programming metrics

Senior Oracle APEX Developer Job Job Details | Yash Technologies

Yash Technologies Pvt Ltd 5.00 to 8.00 Years Bengaluru/ Bangalore (Karnataka) 22 Apr, 2025

Senior Oracle APEX Developer Job Date: Apr 20, 2025 Job Requisition Id: 61079 Location: Bangalore, KA, IN YASH Technologies is a...

oracle apex development sql and pl/sql optimization agile development practices application performance tuning api integration techniques css html triggers javascript database soap web services debugging

Test Engineer - Automation Testing-Selenium - Pool Job Job Details | Yash Technologies

Yash Technologies Pvt Ltd 2.00 to 3.00 Years Bengaluru/ Bangalore (Karnataka) 22 Apr, 2025

Test Engineer - Automation Testing-Selenium - Pool Job Date: Apr 20, 2025 Job Requisition Id: 61081 Location: Bangalore, KA, IN ...

selenium automation api testing test case design cloud technologies sql querying test automation test cases system integration java writing debugging defect management sql queries automation testing test engineer ui automation agile

GIS Developer

GEOSYS ENTERPRISE SOLUTIONS Pvt. Ltd 10.00 to 13.00 Years Hyderabad/ Secunderabad (Telangana) 22 Apr, 2025

Geosys Enterprise Solutions Pvt Ltd.(Geosys) is an ISO 9001:2015 certified company which has been recognised as one of the 20 Most Promising GIS Solution Providers in 2017 in India by CIOReview. Since...

css authoring mvvm asp.net html api c# python remote sensing javascript arcgis esri storage database security microsoft .net mobile infrastructure

Infogain looking for QA Automation Engineer (Senior), Bangalore, India 6-8 Years Experience in SDET

Infogain Corporation 6.00 to 8.00 Years Bengaluru/ Bangalore (Karnataka) 22 Apr, 2025

: QA Automation Engineer (Senior) Location: Bangalore, India Posted on: February 09, 2025 Share on

Automation Engineer - L4

Wipro Technologies Ltd 3.00 to 5.00 Years Bengaluru/ Bangalore (Karnataka) 22 Apr, 2025

Wipro Limited (NYSE: WIT, BSE: 507685, NSE: WIPRO) is a leading technology services and consulting company focused on building innovative solutions that address cli...

automation architecture test automation development agile methodology software validation processes communication skillsautomation framework performance testing test cases database testing tools database programming metrics

Developer(Contract)

Wipro Technologies Ltd 3.00 to 5.00 Years Hyderabad/ Secunderabad (Telangana) 22 Apr, 2025

Role Purpose The purpose of this role is to design, test and maintain software programs for operating systems or applications which needs to be deployed at a client...

software development problem analysis coding standards client collaboration test automation continuous integration test cases software development life cycle usability software validation

Developer - L4

Wipro Technologies Ltd 2.00 to 5.00 Years Bengaluru/ Bangalore (Karnataka) 22 Apr, 2025

Wipro Limited Company Overview Wipro Limited (NYSE: WIT, BSE: 507685, NSE: WIPRO) is a leading technology services and consulting company focused on building innova...

software development life cycle quality assurance testing client requirements analysis coding and automation documentation and reporting continuous integration test cases usability software validation

Developer - L2

Wipro Technologies Ltd 3.00 to 5.00 Years Hyderabad/ Secunderabad (Telangana) 22 Apr, 2025

Wipro Limited Wipro Limited (NYSE: WIT, BSE: 507685, NSE: WIPRO) is a leading technology services and consulting company focused on building innovative solutions that address clients...

software development life cycle coding and testing documentation and reporting requirement analysis client interaction and feedback continuous integration test cases usability software validation

Developer - L2

Wipro Technologies Ltd 2.00 to 5.00 Years Hyderabad/ Secunderabad (Telangana) 22 Apr, 2025

Wipro Limited (NYSE: WIT, BSE: 507685, NSE: WIPRO) is a leading technology services and consulting company focused on building innovative solutions that address cli...

software development quality assurance problem analysis system performance documentation standards continuous integration test cases software development life cycle usability software validation

Developer - L3

Wipro Technologies Ltd 2.00 to 5.00 Years Chennai (Tamil Nadu) 22 Apr, 2025

Wipro Limited (NYSE: WIT, BSE: 507685, NSE: WIPRO) is a leading technology services and consulting company focused on building innovative solutions that address clients most complex...

software development quality assurance problem analysis process automation client communicationcontinuous integration test cases software development life cycle usability software validation

Developer - L3

Wipro Technologies Ltd 2.00 to 5.00 Years Bengaluru/ Bangalore (Karnataka) 22 Apr, 2025

Wipro Limited Wipro Limited (NYSE: WIT, BSE: 507685, NSE: WIPRO) is a leading technology services and consulting company focused on building innovative solutions that address clients...

software development life cycle quality assurance expertise root cause analysis client requirements analysis documentation and reporting continuous integration test cases usability software validation

Developer - L3

Wipro Technologies Ltd 3.00 to 5.00 Years Bengaluru/ Bangalore (Karnataka) 22 Apr, 2025

Company: Wipro Limited (NYSE: WIT, BSE: 507685, NSE: WIPRO) Industry: Technology Services and Consulting Website: www.wipro.com ...

software development quality assurance client interaction root cause analysis process automation continuous integration test cases software development life cycle usability software validation

Senior Technology Architect - Java

Wipro Technologies Ltd 1.00 to 4.00 Years Pune (Maharashtra) 22 Apr, 2025

: Senior Technology Architect - Java Job Summary: Seeking a highly experienced and dynamic Senior Technology Architect / Presales professional / Practice Professiona...

java technologies expertise cloud proficiency (aws/azure) microservices architecture technical documentation skillsleadership and mentoring information technology spring software engineering oracle hibernate spring boot system architecture lea

WordPress & Creative Designer - Gurugram

Montek Tech Services Pvt Ltd 2.00 to 5.00 Years Gurugram 15 Apr, 2025

Engineering Manager

ATOVITT SERVICES PRIVATE LIMITED 4.00 to 9.00 Years Noida,Delhi, Bangladesh, Port Blair, Bangalore, Chennai, Hyderabad, Gurugram, Kolkata, Pune, Mumbai 15 Apr, 2025

software development

project management

emerging technologies

cad

technical support

continuous improvement

java

strong project management

direct reports

Strategic Sales ConsultantWe are seeking a persuasive and solution-oriented Str

MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 9.00 Years Noida,Delhi, Bangalore, Chennai, Hyderabad, Gurugram, Pune, Mumbai City 15 Apr, 2025

business development management

marketing management

business development

marketing

client relationship management

computer knowledge

IAM ProjectManagement or Product Owner

MNR Solutions Pvt Ltd 5.00 to 10.00 Years Noida,Delhi, Hyderabad, Gurugram 15 Apr, 2025

Project Management/Product Owner - IAM

agile

iam

Chief Marketing Officer (CMO)

MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 9.00 Years Noida,Delhi, Bangalore, Chennai, Hyderabad, Gurugram, Pune, Mumbai City 15 Apr, 2025

Key Responsibilities:

Strategic Planning: Develop and implement comprehensive marketing strategies to increase brand awareness, drive lead gen...
service marketingcentrifugal pumpspumpssales marketingindustrial salesorder execution

Executive Assistant

SMART MOVES 1.00 to 5.00 Years Mumbai City 15 Apr, 2025

Greetings!!

Role :- Executive Assistant

Job Title: Executive Assistant

Reports to: Director of the Company

Job Summ...
communication skillsexecutive supportmicrosoft officeproject coordinationcalendar management

Manager- ( Corporate sales)
MEGMA SERVICES 2.00 to 6.00 Years Navi Mumbai,Mumbai City 15 Apr, 2025

Leading Financial services and Company Advisory firm requires Manager- BD( Corporate sales) - Mulund-Mumbai We are looking out for Manager-BD- corporate services for the client office at Mulund ...
solution salesenterprise salesbanking salescorporate sales manager

Financial Accounting - Mumbai
Asian Paints Limited 1.00 to 5.00 Years Mumbai City 15 Apr, 2025

Overview and understanding of COPA Team activities like cycle execution, validation, MIS preparation, BDC posting etc. 2 Execution of WBS settlement and preparation of marketing MIS at company ...
bank reconciliationfinancial reportingmisfinancial accounting

Project Sales Manager
MNR Solutions Pvt Ltd 2.00 to 7.00 Years Mumbai City 15 Apr, 2025

By engaging the Buyers (& Influencers) of architectural aluminium fabrication solutions and - Continuous mapping of new projects coming up in the assigned territory. Understanding local competi...
architecturebuilding material

Back Office Assistant
GUJARAT CLAY MILLS PVT LTD 0.00 to 1.00 Years Mumbai City 15 Apr, 2025

Salary: 12,000 per month Job Type: Full-time Working Hours: 12 pm to 8 pm. Key Responsibilities: Handle all incoming calls and inquiries related to bookings. Maintain proper booking records a...
back officetelecalling

Corporate Manager
Talish Solutions 2.00 to 7.00 Years Mumbai City 15 Apr, 2025

We have an opening for Corporate Manager for our client in Mumbai. Job Title: Corporate Manager Locations: Central Mumbai |...
corporate salesbusiness developmentcorporate tie-ups

Chief Marketing Officer (CMO)
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 9.00 Years Mumbai City,Pune, Bangalore, Noida, Chennai, Hyderabad, Gurugram, Delhi 15 Apr, 2025

Key Responsibilities:

Strategic Planning: Develop and implement comprehensive marketing strategies to increase brand awareness, drive lead gen...
service marketingcentrifugal pumpspumpssales marketingindustrial salesorder execution

Hiring For Interior Site Supervisor
AASAANJOBS PRIVATE LIMITED Hiring For AASAANJOBS PRIVATE LIMITED 1.00 to 5.00 Years Gurugram,Noida 15 Apr, 2025

We Are Hiring! Position: Site Supervisor Location:Gurgaon an...
project executionsite supervision

Bim Engineer
SHARMA ENTERPRISES 3.00 to 8.00 Years Gurugram,Delhi, Noida, Bhubaneswar, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 15 Apr, 2025

We are searching for a bim modeler creates, manages, and maintains digital 3d models of buildings and structures, using bim software to support design, construction, and building lifecycle activi...
3d modelingarchicadnavisworksrevitsolibrimep design

Senior Project Executive
M/S B NANDI 11.00 to 19.00 Years Gurugram,Delhi, Noida, Oman, Saudi Arabia, Luxembourg, Kuwait, Bangalore, Mauritius, Chennai, Philip 15 Apr, 2025

Senior Project Manager Job Description The Senior Project Manager is responsible for leading teams to deliver projects that span across one or more business units. Will manage resources, sche...
project estimationproject managementproject management officeproject executionproject planning

Piping Engineer
RIANSHI DEVELOPERS PRIVATE LIMITED 2.00 to 7.00 Years Ghaziabad,Kurukshetra, Bhutan, Katihar, Vaishali, Rajahmundry, Karimganj, Janjgir Champa, Ireland, L 15 Apr, 2025

Job description Be part of the solution at Technip Energies and embark on a one-of-a-kind journey. You will be helping to develop cutting-edge solutions to solve real-world energy problems....
solid workspiping designmachine designequipment layoutpiping engineeringequipment modelingpiping layout

Sr. Java Developer
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 3.00 to 8.00 Years Gurugram,Delhi, Bangalore, Chennai, Hyderabad 15 Apr, 2025

Degree in computer sciences, coding, or a related field. At least 8 years experience in Java-based programming. Significant coding skills in Java, with other languages being a major plus. Excepti...
awsspring bootmicroservicesangularspringjavafull stackjava fullstack

Hiring For Online Marketing Executive (Work From Home Or Office Both) DELHI-NCR
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Delhi,Faridabad, Ghaziabad, Noida, Gurugram 15 Apr, 2025

Dear Candidate Greetings fromDesnor Destination Pvt Ltd ! Job Summary Idealises Internet Marketing Agency is looking for Marketing Executive to join our dynamic team and embark on a rewarding...
marketing planningdigitaldisplay advertisingmarketingfreelancingwork from homemarketing communicationpart time

Oracle Transportation Management (WIPRO-PAN INDIA)
Wroots Global Private Limited 6.00 to 10.00 Years Delhi,Bangalore, Chennai, Hyderabad, Gurugram 15 Apr, 2025

IMMEDIATE JOINERS OR NOTICE PERIOD WITH 30-45 DAYS ARE REQUIRED. Key Responsibilities:

Lead the implementation and configuration of Oracle Transporta...
fusiontechnicalotmfunctionalconsulatant

IAM ProjectManagement or Product Owner
MNR Solutions Pvt Ltd 5.00 to 10.00 Years Delhi,Noida, Hyderabad, Gurugram 15 Apr, 2025

Project Management/Product Owner - IAM Look only for PM with Technology projects. B.E/B.Tech, BCA/MCA will be preferred. Managing and leading the Identity and Access Managemen...
agileiam

Executive Assistant (EA) to Sales Head
SANSKAR STAFFING SERVICES 4.00 to 6.00 Years Delhi 15 Apr, 2025

Job Summary The Executive Assistant (EA) to the Sales Head will provide high-level administrative, operational, and strategic support. The role requires a proac...
coordinationoperationsexecutive administrative assistancesales

Chief Marketing Officer (CMO)
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 9.00 Years Delhi,Noida, Bangalore, Chennai, Hyderabad, Gurugram, Pune, Mumbai City 15 Apr, 2025

Key Responsibilities:

Strategic Planning: Develop and implement comprehensive marketing strategies to increase brand awareness, drive lead gen...
service marketingcentrifugal pumpspumpssales marketingindustrial salesorder execution

Oracle Transportation Management (WIPRO-PAN INDIA)
Wroots Global Private Limited 6.00 to 10.00 Years Chennai,Bangalore, Hyderabad, Gurugram, Delhi 15 Apr, 2025

IMMEDIATE JOINERS OR NOTICE PERIOD WITH 30-45 DAYS ARE REQUIRED. Key Responsibilities:

Lead the implementation and configuration of Oracle Transporta...
fusiontechnicalotmfunctionalconsulatant

O2C Specialist Accounts Receivable / Collections / Cash Application Blore Pune
WHITE HORSE MANPOWER CONSULTANCY (P) LTD 1.00 to 6.00 Years Bangalore,Pune 15 Apr, 2025

Job Overview:
We are looking for a dynamic O2C (Order to Cash) cash applicationo2coracleorder to casherpaccounts receivableorder releasedso reductionar collection

Chief Marketing Officer (CMO)
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 9.00 Years Bangalore,Noida, Chennai, Hyderabad, Gurugram, Pune, Mumbai City, Delhi 15 Apr, 2025

Key Responsibilities:

Strategic Planning: Develop and implement comprehensive marketing strategies to increase brand awareness, drive lead gen...
service marketingcentrifugal pumpspumpssales marketingindustrial salesorder execution

Sales Account Manager - Ludhiana
AP Moller - Maersk 8.00 to 15.00 Years Ludhiana,Other Punjab 13 Apr, 2025

Maersk is a global leader in integrated logistics and have been industry pioneers for over a century. Through innovation and transformation we are redefining the boundaries of possibility, continu...
SalesBusiness DevelopmentMarket ResearchCustomer Relationship ManagementCustomer Relationships

Information Technology (HR Specialist)
GANGA ACROWOOLS LIMITED 3.00 to 7.00 Years Ludhiana,Other Punjab 13 Apr, 2025

Company Description Ganga Acrowools Limited, located in Ludhiana, is a renowned manufacturer and exporter of Acrylic Yarns with over 60 years of experience in the industry. The company prides its...
HRISIT security best practicesData analysisReportingLMS platformsData encryptionSystem integrationsMobile app developmentProject management toolsAIbased tools

Architect and Interior designer
Sangima Architects & Interiors 0.00 to 4.00 Years Ludhiana,Other Punjab 13 Apr, 2025

Company Description We are an architect and Interior designing firm located in South city,Ludhiana. Role Description This is a full-time on site role for an Architect and Interior Designer. The...
AutoCADRevitSketchUplumionnavisworksenscape

Development Manager
Willpower Consultants 5.00 to 10.00 Years Ludhiana,Jalandhar, Amritsar, Mohali, Pathankot, Bathinda, Patiala, Moga, Hoshiarpur, Sikar 13 Apr, 2025

Job Role : Recruit Life Advisor under your team to archive business target .Execution of sales strategy to increase market and reach penetration .Build long term relationship with new and existin...
business developmentcasa salesb2cbusiness-to-businessfield salesbanking salesinsurance salessales executivesales manager

Hiring For Electrical Engineer Fresher or Experience
Divya Staffing Solution 0.00 to 4.00 Years Ludhiana,Oman, Qatar, Korba, Raigarh, Baddi, Kuwait, Gwalior, Indore, Raipur, United Arab Emirates, 13 Apr, 2025

This role provides practical experience through involvement in wide-ranging projects and tasks under the guidance of senior engineers, facilitating learning and professional growth. Responsibili...
hand toolsmaintenanceinterior designingtechnician activities

Relationship Manager
KKD Consulting Hiring For KKD Consulting 4.00 to 9.00 Years Ludhiana,Chandigarh, Delhi, Jaipur, Bangalore, Gurugram, Pune, Patna 13 Apr, 2025

Dear Job Seeker, If you are passionate about building a successful career in insurance and possess strong leadership and interpersonal skills, we invite you to apply for this position.
marketingsalesdirect sales

Were Hiring Sr. Agency Manager (Life Insurance)
Niyukti Management Consultants Hiring For Niyukti Management Consultants 4.00 to 9.00 Years Ludhiana,Amritsar, Delhi, Noida, Kanpur, Ghaziabad, Lucknow, Gurugram, Kolkata, Faridabad 13 Apr, 2025

Were Hiring Sr. Agency Manager (Life Insurance)
Industry:...
salessales managerunit managerrelationship managersals executivebusiness managerdevelopment managerarea sales officer

Social Media Executive
Digihive 2.00 to 6.00 Years Lucknow,Other Uttar Pradesh 13 Apr, 2025

Role Description This is a full-time on-site role for a Social Media Executive at Digihive in Lucknow. The role involves managing social media accounts, creating engaging content, analyzing metri...
social media managementcontent creationdigital marketingsocial media analytics

International Sales Manager (Semiconductor industry)
Digital Business People 4.00 to 8.00 Years Lucknow,Other Uttar Pradesh 13 Apr, 2025

Job Title: International Sales Manager We are looking for a self-driven International Sales Manager with expertise in the Semiconductor Industry and/or Testing domain to join our team. The role w...
Semiconductor IndustrySales strategiesProject executionTesting domainClient relationships

PREV
NEXT

integrated campaign execution Job Openings

Key Responsibilities:

Key Responsibilities:

Senior Project Manager Job Description The Senior Project Manager is responsible for leading teams to deliver projects that span across one or more business units. Will manage resources, sche... project estimationproject managementproject management officeproject executionproject planning

Job description Be part of the solution at Technip Energies and embark on a one-of-a-kind journey. You will be helping to develop cutting-edge solutions to solve real-world energy problems.... solid workspiping designmachine designequipment layoutpiping engineeringequipment modelingpiping layout

Key Responsibilities:

Job Overview:

Key Responsibilities:

Were Hiring Sr. Agency Manager (Life Insurance)

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Senior Project Manager Job Description The Senior Project Manager is responsible for leading teams to deliver projects that span across one or more business units. Will manage resources, sche...
project estimationproject managementproject management officeproject executionproject planning

Job description Be part of the solution at Technip Energies and embark on a one-of-a-kind journey. You will be helping to develop cutting-edge solutions to solve real-world energy problems....
solid workspiping designmachine designequipment layoutpiping engineeringequipment modelingpiping layout