payments domain jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

payments domain Job Openings

Showing 2301 - 2350 of 11563 Jobs

SAP Work Manager Developer

CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Chennai, BangaloreBangalore, Noida, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi 25 Sep, 2025

PHP & WordPress Developer

SEOWebPlanet Solutions - Digital Marketing Company in India Fresher Vadodara, Gujarat 24 Sep, 2025

Import Executive

Aviyana Ventures Pvt Ltd Fresher Vasai, BoisarBoisar, Palghar, Mira Bhayandar, Mumbai City 24 Sep, 2025

Recruiter / Junior Recruiter BFSI Recruitment

Team Ace HR LLP Fresher Mumbai City 24 Sep, 2025

Job Title:

Location:

presales consultant

BSH TECHNOLOGIES PRIVATE LIMITED Fresher Bhubaneswar 24 Sep, 2025

Work closely with the Business Development & Sales teams to support lead qualification and opportunity conversion.
Conduct r...
crmpresentationsclientsmbsoftwaresalestoolsexcelpowerpointdemosmarketproposalsstrongmandatory.knowledgesystems.serviceslikeestimationsusing

Accountant/cashier

BN Recruitment Services Hiring For bank Fresher Ranchi, JaipurJaipur, Dehradun, Indore, Lucknow, Kolkata, Pune, Chandigarh, Bhopal, Allahabad 24 Sep, 2025

Hiring In Banking:

Accountant/Cashier We are looking for an Accountant to manage all financial transactions, from fixed payments and variable expenses to bank deposits and budgets. Acc...
customer servicefinancial managementcash handlingcommunicationrisk management

Operations Analyst

PSS Consultant Fresher Pondicherry, MaduraiMadurai, Coimbatore, Chennai, Bangalore, Kochi, Bellary, Thrissur, Belgaum, Hubl 24 Sep, 2025

Pss Consultant

Hiring For Banking

operations analystDescription

An operations analyst at an investment bank is responsible for risk m...
customer supportcompliancepayment processingbanking analytics

Area Service Incharge B
Reliance Jio Infocomm Limited Fresher Jalandhar, Punjab 24 Sep, 2025

As a Service Center Manager in our company located in Jalandhar, your role will involve: - Establishing and maintaining the upkeep of service centers - Liaising with store managers and sales team...
Team managementMarket knowledgeRelationship managementExperience in areazone for device repair operationsGeography knowledgeDelegation skillsDiversity managementDomain knowledge of telecom deviceExpertise in field repair operations

Data Science Trainee / Junior Data Scientist
Bloom Infotech Fresher Punjab 24 Sep, 2025

As a Data Science fresher, you will be part of our team where you will have the opportunity to apply your analytical and problem-solving skills on real-world datasets. You will collaborate closely...
PythonNumPySQLData VisualizationStatisticsProbabilityPandasScikitlearn

Position Project Manager {Project Planning & Co-ordination (For TFL & NRL)
HR JOBS CONSULTANCY Fresher Lucknow, NoidaNoida, Ghaziabad, Bangalore, Indore, Chattisgarh, Hyderabad, Kolkata, Gurugram, Chandi 24 Sep, 2025

Position: ProjectManager {Project Planning & Co-ordination (For TFL & NRL) Qualification: B.E, Mechanical Experience: 15-25 Years of relevant experience. Experience in Project Planning, Schedu...
project managementproject coordination

Operations Analyst
PSS Consultant Fresher Kochi, ThrissurThrissur, Bangalore, Madurai, Chennai, Bellary, Pondicherry, Belgaum, Hubli, Coimbato 24 Sep, 2025

Pss Consultant Hiring For Banking operations analystDescription An operations analyst at an investment bank is responsible for risk m...
customer supportcompliancepayment processingbanking analytics

Content & Copywriting Intern/Trainee
Marketing as Sales support Fresher Kochi, Kerala 24 Sep, 2025

Role Overview: As a part of MaSs, a digital marketing agency based in the UK with operations in Kochi, you will be part of a team that focuses on vibe marketing - creating messages that stand out,...
CopywritingContent CreationEditingGrammarAdaptabilityFeedbackCreativityAI Tools

Operations Analyst
PSS Consultant Fresher Kochi, ThrissurThrissur, Bangalore, Madurai, Chennai, Bellary, Pondicherry, Belgaum, Hubli, Coimbato 24 Sep, 2025

Pss Consultant Hiring For Banking operations analystDescription An operations analyst at an investment bank is responsible for risk m...
customer supportcompliancepayment processingbanking analytics

Application Sales Jodhpur (IVD)
ACCUREX BIOMEDICAL PRIVATE LIMITED Fresher Jodhpur, Rajasthan 24 Sep, 2025

As an Application Sales Specialist at Accurex Biomedical in Jodhpur, you will be responsible for providing clinical application support and driving sales in the IVD domain. Your role will involve...
Application SupportSalesMarket IntelligenceDiagnostic InstrumentsCustomer Queries

Specialist I - SE - React , Typescript
UST Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

Role Overview: As a Lead Software Engineer within our enterprise product domain, you will play a pivotal role as both an expert individual contributor and a technical multiplier. You will be respo...
JavascriptReactJsNodeJs

Business Development Consultant
Velodata Global Pvt Ltd Fresher Kochi, Kerala 24 Sep, 2025

As a Business Development Consultant for IT Services in Dubai, UAE, you will play a crucial role in expanding the companys presence in the region and beyond. Your primary responsibilities will inc...
Business DevelopmentIT servicesSales GrowthMarket TrendsLead GenerationMentoringPresalesMarketingCold CallingHubSpotIT SolutionsClient RelationshipsProposal PresentationsDeal Closing

Workday Finance Techno-functional Consultant Senior
Butterfly Groups Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

Role Overview: As a Workday Finance Techno-functional Consultant at our company, you will play a crucial role in leading or supporting Workday Financials implementations and post-go-live activitie...
Web ServicesSOAPRESTXMLXSLTJSONMatrixBIRTWorkday StudioEIBCore ConnectorsWorkday Prism AnalyticsAccounting CenterWorkday SecurityBusiness Process ConfigurationWorkday ReportingCompositeAdvancedDiscovery BoardsCalculated Fields

Relationship Officer
SKILLNIX RECRUITMENT SERVICES PRIVATE LIMITED Fresher Thrissur 24 Sep, 2025

Hiring Relationship Officer (Life Insurance) Thrissur | CTC 3.90 LPA Body: Dear Candidate, We are hiring for the position of Relationship Officer with a leading Life Insurance Company. salesbfsi salesfield sales

Operations Analyst
PSS Consultant Fresher Coimbatore, PondicherryPondicherry, Chennai, Bangalore, Thanjavur, Thirunelveli, Madurai, Salem, Ero 24 Sep, 2025

Pss Consultant Hiring For Banking operations analystDescription An operations analyst in banking monitors and improves operational pr...
customer supportcompliancebanking analyticscustomer

Audit Manager
A K Salampuria & Associates | Chartered Accountants Fresher Patna, Bihar 24 Sep, 2025

As an Audit Manager at A K Salampuria & Associates, your role will involve leading and managing audit teams under the supervision of a Partner. You will be responsible for ensuring timely completi...
AuditBank AuditDirect TaxStatutory AuditInternal AuditConcurrent AuditTaxationInsurance Audit

Fraud Analyst
JOBGONIC PRIVATE LIMITED Fresher Pune 23 Sep, 2025

Risk Investigator Associates are ambassadors who earn customer loyalty by delivering personalized, convenient, and secure service. They maintain a high-quality customer experience through a custo...
bank fraudfraud investigationcheck fraudinsurance fraudidentity fraudfraud claimsfraud detectionfraud managementfraud analyst

Position Project Manager {Project Planning & Co-ordination (For TFL & NRL)
HR JOBS CONSULTANCY Fresher Noida, GhaziabadGhaziabad, Lucknow, Bangalore, Indore, Chattisgarh, Hyderabad, Kolkata, Gurugram, Ch 23 Sep, 2025

Position: ProjectManager {Project Planning & Co-ordination (For TFL & NRL) Qualification: B.E, Mechanical Experience: 15-25 Years of relevant experience. Experience in Project Planning, Schedu...
project managementproject coordination

Accountant Hospitality industry_Nariman point
Zodiac HR Consultants (I) Pvt Ltd Fresher Mumbai City 23 Sep, 2025

Job Title:
Location:[Nariman point]

Department:Finance & Accounts
EXPERIENCE- 5 years CTC- 9 LPA Immediate jopiner ...
account managementhospitalityaccounts officeraccountantaccountfinance executive

Position Project Manager {Project Planning & Co-ordination (For TFL & NRL)
HR JOBS CONSULTANCY Fresher Gurugram, GhaziabadGhaziabad, Noida, Bangalore, Indore, Chattisgarh, Hyderabad, Lucknow, Kolkata, Ch 23 Sep, 2025

Position: ProjectManager {Project Planning & Co-ordination (For TFL & NRL) Qualification: B.E, Mechanical Experience: 15-25 Years of relevant experience. Experience in Project Planning, Schedu...
project managementproject coordination

US Collection Agents
Sharda Consultancy Services Fresher Gurugram, Noida 23 Sep, 2025

Location:Gurugram, Noida Salary: 40k CTC Incentives Shift Timing: 5:30 PM 9 Hours 6:30 PM 9 Hours 7:30 PM 9 Hours 8:30 PM 9 Hours Rotational Off: Saturday & Sunday Off Working Days: 5 Days ...
salesinternationalcollections processthird party collectionscollectionsb2c sales

JD Edwards SND Consultant
LTIMindtree Limited Fresher Gurugram, DelhiDelhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 23 Sep, 2025

Role -JDE SND Exp - 2 to 8 Yrs Salary - Best in Industry Location - PAN India Sales and Distribution domain knowledge and experience. Having at least 2 full life cycle implementation experien...
jde - distributionjde

Position Project Manager {Project Planning & Co-ordination (For TFL & NRL)
HR JOBS CONSULTANCY Fresher Ghaziabad, NoidaNoida, Bangalore, Indore, Chattisgarh, Hyderabad, Lucknow, Kolkata, Gurugram, Chandi 23 Sep, 2025

Position: ProjectManager {Project Planning & Co-ordination (For TFL & NRL) Qualification: B.E, Mechanical Experience: 15-25 Years of relevant experience. Experience in Project Planning, Schedu...
project managementproject coordination

JD Edwards SND Consultant
LTIMindtree Limited Fresher Delhi, NoidaNoida, Bangalore, Chennai, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City 23 Sep, 2025

Role -JDE SND Exp - 2 to 8 Yrs Salary - Best in Industry Location - PAN India Sales and Distribution domain knowledge and experience. Having at least 2 full life cycle implementation experien...
jde - distributionjde

Quality Assurance, Monitoring & Testing Analyst 2
Citi Fresher Chennai, Tamil Nadu 23 Sep, 2025

As a Business Risk and Control Analyst II at Citi, you will be a part of the Central Testing team within the Central Control Capabilities function. Your primary responsibility will be to drive Mon...
CommunicationControls AssessmentStakeholder ManagementAnalytical ThinkingAssurance StrategyConstructive DebateControls LifecyclePolicyProcedure

SBA AP Payments SSC
Welspun World Fresher Ahmedabad, Gujarat 23 Sep, 2025

Role Overview: You will be responsible for overseeing and managing the overall financial operations within the treasury and finance department at Welspun. You will play a crucial role in utilizing...
AccountingFinancial OperationsFinancial ReportingAccounting StandardsBusiness AcumenEntrepreneurshipTeam CollaborationSAPERP SystemsCommercial AcumenGlobal Mindset

Associate Consultant
iMark Info360 Fresher Ahmedabad, Gujarat 23 Sep, 2025

As a part of iMark, you will be presented with exciting opportunities in diversified industry verticals and geographies. Whether you are an experienced professional or at the beginning of your car...
Finance

SAP IM Consultant
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Kolkata, GurugramGurugram, Mumbai City, Bangalore, Noida, Chennai, Hyderabad, Pune, Delhi 20 Sep, 2025

SAP IM-Investment management JD:

Functional (Domain) Bachelors degree , Business Administration, or a related field with minimu...
investmentmanagement

Accounts Receivable Executive
YOUTAG INFOTECH PRIVATE LIMITED Fresher Kolkata, GurugramGurugram, Mumbai City, AndamanNicobar, Bangalore, Noida, Chennai, Hyderabad, Pune, 20 Sep, 2025

We are looking for an analytical accounts receivable specialist to assist our accounting department as it receives, processes, and collects on goods sold or services rendered. In this role, you w...
amortization schedulesdepreciationfas asset accountingclosing entriesjournal entriesclose processamortization

SAP Work Manager Developer
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Kolkata, GurugramGurugram, Mumbai City, Bangalore, Noida, Chennai, Hyderabad, Pune, Delhi 20 Sep, 2025

SAP WorkManager: Primary Skill: SAP Work Manager Delivery Role: Sr. Developer Experience Profile: 06-10 years Candidate should have good knowledge and working experience of SAP Agentry/Work M...
spmmobile developmentjavasap work managerworkdevelopermanager

Workday HCM Consultant
GLOBEX DIGITAL SOLUTIONS PRIVATE LIMITED Fresher Kolkata, GurugramGurugram, Mumbai City, Bangalore, Chennai, Noida, Hyderabad, Vishakhapatnam, Pune, 20 Sep, 2025

We need some strong profiles in Studio and Extend and strong HCM Functional (specialization in UK payroll is a addon or any other module like onboarding or absence )<...
studiohcmworkdayuk payrollextendpeci

Product Test Engineer
Eruvaka Technologies Fresher Vijayawada, Andhra Pradesh 20 Sep, 2025

As a Product Validation Tester for IoT products, you will be responsible for conducting validation tests encompassing hardware, software, and mechanical components. Your role will involve executin...
WiFiBluetoothFunctionalEnvironmental TestingIoT Product Testing TechniquesProblemSolvingAnalytical SkillsTest Equipment SetupManagementTest Data AnalysisReportingCommunicationCollaboration SkillsFamiliarity with AgileWaterfall methodologies

Mgr., Training Operations
Numerator Fresher Vadodara, Gujarat 20 Sep, 2025

As a Team Trainer at Numerator, you will play a pivotal role in ensuring the accuracy of team tasks in specific knowledge areas and act as the primary liaison between the Hub and local markets. Yo...
Market ResearchConsumer BehaviorData AnalysisPerformance MetricsMicrosoft Excel

Accounting Technician
RAJPUT PROTECTION SERVICE PRIVATE LIMITED Fresher Raipur, BhillaiBhillai, Canada, Patna, Guwahati, Bangalore, Noida, Chennai, Hyderabad, Germany, Chan 20 Sep, 2025

Performing administrative tasks such as arranging payroll and administering payments for invoices. Book-keeping tasks. Operating software packages to record and retrieve information, p...
key account developmentengineering designconstruction managementengineering consultancyplant designconstructabilityaccounts finalisationaccount management

Sap Mm & Sap ABAP consultant
Jigyansa Panda Hiring For wbey Fresher Udaipur, GurugramGurugram, Punjab 20 Sep, 2025

Hello All, I have immediately hiring in couple of SAP MM/S4HANA & SAP ABAP with 8 Years of experience. SAP MM/S4HANA: JD: SAP MM ,S4HANA & Oil/Gas experience (Prefer) sap mmsap abap

Marketing & Sales Manager
Inext securities automationpvtltd Fresher Raipur 20 Sep, 2025

As a Sales & Marketing Manager at ISAPL, you will be responsible for developing and executing marketing strategies to promote AMC services in the security and surveillance domain. Your role will i...
MarketingSalesRelationship buildingLead generationClient managementProposal preparationMarket analysisCompetitor analysisCommunication skillsPresentation skillsInterpersonal skillsNegotiation skills

Accounting Technician
RAJPUT PROTECTION SERVICE PRIVATE LIMITED Fresher Raipur, BhillaiBhillai, Canada, Patna, Guwahati, Bangalore, Noida, Chennai, Hyderabad, Germany, Chan 20 Sep, 2025

Performing administrative tasks such as arranging payroll and administering payments for invoices. Book-keeping tasks. Operating software packages to record and retrieve information, p...
key account developmentengineering designconstruction managementengineering consultancyplant designconstructabilityaccounts finalisationaccount management

JD Edwards SND Consultant
LTIMindtree Limited Fresher Pune, BangaloreBangalore, Noida, Chennai, Hyderabad, Gurugram, Kolkata, Mumbai City, Delhi 20 Sep, 2025

Role -JDE SND Exp - 2 to 8 Yrs Salary - Best in Industry Location - PAN India Sales and Distribution domain knowledge and experience. Having at least 2 full life cycle implementation experien...
jde - distributionjde

SAP IM Consultant
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Pune, BangaloreBangalore, Noida, Chennai, Hyderabad, Kolkata, Gurugram, Mumbai City, Delhi 20 Sep, 2025

SAP IM-Investment management JD:

Functional (Domain) Bachelors degree , Business Administration, or a related field with minimu...
investmentmanagement

Digital Marketing Executive
Bulls Assets Investment Solutions Fresher Nagpur, Maharashtra 20 Sep, 2025

You are looking for a Digital Marketing & Lead Generation Specialist with excellent content creation skills to enhance and expand the brands visibility on Social Media platforms. As a key member o...
Social Media MarketingLead GenerationContent WritingStorytellingGoogle AnalyticsDigital Content CreationGraphic Creation

JD Edwards SND Consultant
LTIMindtree Limited Fresher Noida, DelhiDelhi, Bangalore, Chennai, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City 20 Sep, 2025

Role -JDE SND Exp - 2 to 8 Yrs Salary - Best in Industry Location - PAN India Sales and Distribution domain knowledge and experience. Having at least 2 full life cycle implementation experien...
jde - distributionjde

Recovery Manager
FASTSURANCE CONSULTANTS PRIVATE LIMITED Fresher Noida 20 Sep, 2025

-
The Recovery Manager will oversee and drive the recovery of outstanding success fees while leading and managing a team of Recovery Executives. This includ...
recovery managementdebt recoveryrecovery

Cyber Security Content Creator
Cyberverse Foundation Fresher Mysore, Karnataka 20 Sep, 2025

As a Cybersecurity Intern at our company, you will have the opportunity to showcase your passion for cybersecurity by creating impactful content that educates and informs. Your role will involve c...
phishingfirewallsnetwork securitycommunication skillsMicrosoft PowerPointMicrosoft ExcelGoogle Sheetscybersecuritymalwarescreen recordingOBS Studio

Position Project Manager {Project Planning & Co-ordination (For TFL & NRL)
HR JOBS CONSULTANCY Fresher Lucknow, NoidaNoida, Ghaziabad, Bangalore, Indore, Chattisgarh, Hyderabad, Kolkata, Gurugram, Chandi 20 Sep, 2025

Position: ProjectManager {Project Planning & Co-ordination (For TFL & NRL) Qualification: B.E, Mechanical Experience: 15-25 Years of relevant experience. Experience in Project Planning, Schedu...
project managementproject coordination

Senior Backend Engineer / Architect
BEO Software Private Limited Fresher Kochi, Kerala 20 Sep, 2025

Role Overview: You will be responsible for the architecture and implementation of scalable REST/GraphQL APIs driven by OpenAPI specifications. Your role will involve data model and persistence usi...
PostgreSQLSQLRedisGitHubDockerRESTGraphQL APIsOIDCOAuth2Azure Service BusOpenTelemetryCICDTypeScriptNodejsAzure AKSApp ServiceOpenAPISwagger

Senior Software Engineer
Fingent Fresher Kochi, Kerala 20 Sep, 2025

You will be a Senior Software Engineer in the .NET domain at Fingent, where we believe in leveraging technology to create a positive impact on the lives of people. Our software solutions are desig...
jQueryEntity FrameworkLINQSQL AzureAppFabricCNETASPNET MVC FrameworkNet CoreAngular 2OOPS conceptsWeb API

PREV
NEXT

payments domain Job Openings

Hiring In Banking:

Accountant/Cashier We are looking for an Accountant to manage all financial transactions, from fixed payments and variable expenses to bank deposits and budgets. Acc... customer servicefinancial managementcash handlingcommunicationrisk management

Job Title:

Location:[Nariman point]

Department:Finance & Accounts

-

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Accountant/Cashier We are looking for an Accountant to manage all financial transactions, from fixed payments and variable expenses to bank deposits and budgets. Acc...
customer servicefinancial managementcash handlingcommunicationrisk management