people engagement activities jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

people engagement activities Job Openings

Showing 20101 - 20150 of 53111 Jobs

Financial Management

M/S AASTHA LIFECARE CORPORATION PRIVATE LIMITED 11.00 to 21.00 Years Hyderabad,Bangalore, Chennai, Kolkata, Gurugram, West Siang, Bhillai, Silvassa, Port Blair, Dibrugar 01 Apr, 2025

Account Management Director

SPENTO PAPERS (INDIA) LLP 12.00 to 22.00 Years Hyderabad,Bangalore, Noida, Chennai, Gurugram, Kolkata, Pune, Tadepalligudem, Mumbai City, Delhi 01 Apr, 2025

Sales Engineer

Ikamate HR India Pvt Ltd 2.00 to 7.00 Years Hyderabad,Madurai, Chennai, Vijayawada, Pune, Nagpur 01 Apr, 2025

key account management

Head Chef (Industrial Canteen)

MALABAR GOLD LIMITED 5.00 to 10.00 Years Hyderabad,Other Telangana 01 Apr, 2025

Greeting from Malabar!

Job Title : Head Chef ( Industrail Canteen) Experience :

Location

Department<...
kitchen managementmenu planninginventory managementhygienist activitiesindustrial

Pharmacovigilance Associate
CLIN BIOSCIENCES 0.00 to 1.00 Years Hyderabad,Bangalore, Pune, Mumbai City 01 Apr, 2025

Roles and Responsibilities

Adverse event collection and reporting: Receiving and reviewing adverse event reports fro...
argus safetyarisgdrug safety

DLP Specilaist
MNR Solutions Pvt Ltd 3.00 to 7.00 Years Hyderabad,Gurugram, Delhi 01 Apr, 2025

DLP Location-Pan India Grade-P2/P3/P4 NP-30 days Job Overview: We are seeking a skilled Data Loss Prevention (DLP) Specialist to join our I...
qradardlpseim

Pre Sales Executive
DIGITALCUBE CONSULTANCY SERVICES PRIVATE LIMITED 1.00 to 3.00 Years Hyderabad,Delhi 01 Apr, 2025

Designation:Pre-Sales Executive Experience Required:6month to 2years Location: presalestele sales

Plant Engineer
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 12.00 to 22.00 Years Hyderabad,Bangalore, Noida, Chennai, Nellore, Gurugram, Kolkata, Pune, Mumbai City, Delhi 01 Apr, 2025

We are looking for a Plant Manager to drive continuous improvement and optimization of all processes.
Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla...
project engineeringprocess equipmentengineering processengineeringplant engineering

Debt Manager
Live Connections 3.00 to 7.00 Years Hyderabad 01 Apr, 2025

Description Job Requirements Job Title Collection Manager-BIL, Personal Loan and MBL Functio...
collections processcollection strategyrecovery managementconsumer debtcollection managementcollection systemsdebt collection

Business Development Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 8.00 to 12.00 Years Hyderabad,Bangalore, Noida, Chennai, Gurugram, Pune, Mumbai City, Delhi 01 Apr, 2025

Key Responsibilities:

Strategic Planning: Develop and execute strategic business development plans that align with company goals and target ma...
sales growthanalysismarket analysisadaptabilityadministration workmarketcommunicationstrategic planningstrategic thinkinginnovationnegotiationcontractsresearch

Automation Testing
Srijan Spectrum Pvt Ltd 8.00 to 13.00 Years Hyderabad,Bangalore, Noida, Chennai, Gurugram, Kolkata, Pune, Mumbai City, Delhi 01 Apr, 2025

Automation Engineer Exp : 9 - 15 Notice : 0 - 30 Days Location : Remote Skills : UI Automation, ETL Automation, UAT Testing Timing : 12.30 PM - 9.30 PM Must Have Lead experience ui testinguat

Insurance Sales
RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 1.00 to 6.00 Years Hyderabad 01 Apr, 2025

Job Summary: As a Frontline Sales Representative, you will interact directly with customers to generate leads, drive sales, and build long-term rel...
frontinsurancesaleslinedirect

Exciting Data Entry Executive Role Work from Home Opportunity
Pick Bright HR Solution 0.00 to 1.00 Years Gwalior,Bangalore, Chennai, Bidar, Udupi, Thane, Thrissur, Yavatmal, Surat, Chatra 01 Apr, 2025

Dear candidate, We are excited to announce immediate openings for Part-Time Data Entry Operator roles with our company, available for candidates across India. skills needed: basic computer know...
english writingdata entry

Procurement Assistant
SHARMA ENTERPRISES 1.00 to 6.00 Years Gwalior,Indore, Bhopal, Ernakulam, Kochi, Bokaro, Malappuram, Kozhikode, Thrissur, Ranchi 01 Apr, 2025

We are currently searching for a Procurement Assistant supports the purchasing and supply chain processes, assisting with tasks like sourcing suppliers, preparing purchase orders, maintaining pro...
purchase operationssupplier quality assurancesourcing materialsinventory managementrecord maintenancedata analysisrecord keeping

Hiring Hiring Agency Development Manager For Life Insurance salary 4.5
Niyukti Management Consultants Hiring For Niyukti Management Consultants 5.00 to 10.00 Years Gwalior,Ujjain, Indore, Bhopal, Jabalpur, Jaipur, Jodhpur, Udaipur, Pune, Nagpur 01 Apr, 2025

Agency Development Manager Life Insurance Comp Location Salary- Upto 4lac Rimb Incentive Exp- 2-10Year sal...
salesdirect salesagency salessales development managerunit managerrelationship managersales executiveagency development manager

Posting Insurance Sales Manager
Niyukti Management Consultants Hiring For Niyukti Management Consultants 3.00 to 8.00 Years Gwalior,Ujjain, Indore, Bhopal, Jabalpur, Patiala, Amritsar, Jalandhar, Ludhiana, Delhi 01 Apr, 2025

Job Description / Responsibilities:

life insurancesalesdevelopment managerdistribution manageragency development managersales officersales executive

Warehouse Supervisor
SHARMA ENTERPRISES 1.00 to 6.00 Years Gwalior,Indore, Bhopal, Bishnupur, Imphal, Shillong, Imphal West, Senapati, Churachandpur, Thoubal 01 Apr, 2025

We are looking for an experienced warehouse supervisor to manage and oversee all warehouse activities, ensure efficient processes, and maximize warehouse productivity. The warehouse supervisors r...
performancesupervisioninventorysafetymonitoringleadership

Assistant Teacher in DAV
RENOVISION TECHNOLOGY 0.00 to 1.00 Years Gwalior,Indore, Bhopal, Nashik, Bhubaneswar, Cuttack, Rourkela, Fatehgarh Sahib, Ferozpur, Hoshiarpu 01 Apr, 2025

We are seeking an experienced and dedicated preschool teacher to join our team. The successful candidate will be responsible for creating a safe and nurturing learning environment fo...
educational consultingteacher trainingeducation reformteacher mentoringteacher evaluation

Product Manager
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 15.00 to 25.00 Years Gwalior,Indore, Bhopal, Jabalpur, Ratlam, Sagar, Ernakulam, Pala, Wayanad, Thiruvananthapuram 01 Apr, 2025

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c...
product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing

Hr Manager
Wingexcel services 4.00 to 9.00 Years Gurugram,Delhi 01 Apr, 2025

Urgent Hiring For Sr. HR Executive Or Assistant Manager HR Company Profile - Manufactring Salary - Upto 35kpm Or Negotiable for deserving Candidate Salary - Upto 35kpm Or Negotiable Experience - ...
hr administrationhr generalist activities

Chat Support Executive
JDM CONSULTANCY 1.00 to 5.00 Years Gurugram,Delhi 01 Apr, 2025

Dear Candidate, We have Urgent Hiring for Chat Executive in IGT Solutions : Roles and Responsibilities : _Develop and implement e-commerce st...
chat processnon voicecustomer servicebpoemailemail processchatbackend operations

Relationship Manager
CAREER AHEAD 1.00 to 4.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

Dear candidate, We are hiring for Sales Manager & Relationship Manager. Experience: 1 year CTC: as per industry standards incentives Location: Pan India
Key Responsibilities: field salesgold valuationgold loan operationsgold loanbfsi salesrelationship managerrelationship officersales manager

Sr. Managing Partner APC Life Insurance Company salary upto 7Lac
Niyukti Management Consultants 6.00 to 11.00 Years Gurugram,Delhi, Faridabad, Noida, Karnal, Sirsa, Dehradun, Jaipur, Indore, Bhopal 01 Apr, 2025

Job Opening: Sr. Managing Partner APC Life Insurance Company Location: Delhi, Gurugram, Noida, Faridaba...
life insurancesalesunit managerbusiness development managerdeputy branch manager sourcingdevelopment managersales manageragency development managerbusiness manager

Data Entry from home - No Experience Needed
VRD INFOTECH 0.00 to 1.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Bhopal 01 Apr, 2025

Dear candidate, We are seeking a meticulous Data Typing Specialist to join our team. Skills Needed: Basic computer knowledge Work Conditions: No age bar, no work pressure, no targets. Both ma...
data entryexcelback office

Freelance Recruiter and Intern
KKD Consulting Hiring For KKD 0.00 to 1.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida, Sonipat, Palwal, Mumbai City, Meerut 01 Apr, 2025

Job Title: Freelance Recruiter & Recruitment Intern Location: Remote Job Type: Freelance / Internship
About Us:
[Y...
callingscreening

Sr HRBP Associate -Gurugram
MEGMA SERVICES 3.00 to 6.00 Years Gurugram 01 Apr, 2025

Leading engineering and construction company requires Sr HRBP Associate - Gurugram One of our client luxury brand which is Indias leading manufacturer of premium doors, windows, wood house and t...
hr operationshrbpassociate

Hiring for Field Sales Executive in Delhi NCR
AASAANJOBS PRIVATE LIMITED 1.00 to 5.00 Years Gurugram,Delhi 01 Apr, 2025

Meta Job Description Job Title: Sales Consultant Location: Delhi NCR Salary: 25000 CTC (Including Petrol allowance of 2000) Experience: 0-1 year Qualification : Graduate ...
salesfield salessales executive activities

E-commerce Account Managment Lead - CBT (Cross Border Trade)
ACUITTY CONSULTANTS LLP Hiring For AcuittyTech 1.00 to 2.00 Years Gurugram 01 Apr, 2025

Key Responsibilities: As an e-commerce account manager, you will work with one of the worlds largest companies to guide their partners ( business-to-businesskey account managementaccountabilitycommunication skillsexport import documentationrelationship buildingms excele-commerce account managementproduct listing

Manager Hrd
Employee deal consultants Hiring For A Reputed Readymade Garment Export House 15.00 to 25.00 Years Gurugram 01 Apr, 2025

A reputed garment export House is looking for a HR Head. The company has 3 units in Gurugram . HR Officers in all units will be gradualy reporting to him. The opening is based in Head Office and ...
hr compliancelabour lawshr generalist activitieslabour welfare

Quantity Surveyor
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Guwahati 01 Apr, 2025

Also known as cost consultants, quantity surveyors ensure building projects remain within budget. They provide cost and material estimates, draw up projected budgets, and work alongside a team, ...
quality managementquantity analysisquantity surveyingquality assurancequantity estimationquality control

Marketing Executive
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Bhagalpur, Hyderabad, Pune, Patna, Guwahati 01 Apr, 2025

Marketing executives coordinate and oversee campaigns geared at promoting products, services, and causes. Marketing executives are adept at a variety of platforms, including print and social med...
marketing researchmarketing communicationmarketing managementbrand managementmarketing

Hiring For Online Marketing Executive (Work From Home Or Office Both) DELHI-NCR
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 01 Apr, 2025

Dear Candidate Greetings fromDesnor Destination Pvt Ltd ! Job Summary Idealises Internet Marketing Agency is looking for Marketing Executive to join our dynamic team and embark on a rewarding...
marketing planningdigitaldisplay advertisingmarketingfreelancingwork from homemarketing communicationpart time

Head Admin
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 5.00 to 10.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 01 Apr, 2025

Main Responsibilities:

Strategic Planning:

Identify opportunities for operational efficiency and cost savings within the administrative functions.

Prepare an...
administration managementoffice operationstravel deskfacility managementfacility operationscorporate administration

Quality Assurance Engineer
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 3.00 to 8.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

The QA technician role plays an important part in our companys product development process. Our ideal candidate will be responsible for conducting tests before product launches to ensure softwar...
automation testingmanual testingprocessqa analystquality analysttest engineerqualitytestingtest managerqa manager

Lead Maintenance Supervisor
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 3.00 to 7.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 01 Apr, 2025

Key Responsibilities:

Team Supervision:

Lead, train, and mentor a team of maintenance technicians and staff.

Assign tasks and p...
programmingwellnessinspectionmanagementvalvesschedulingsafety trainingexecutive engineering

Account Management Director
SPENTO PAPERS (INDIA) LLP 12.00 to 22.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Tadepalligudem, Mumbai City 01 Apr, 2025

We are seeking an experienced Account Management Director to lead and optimize our Account Management team. This leadership role will focus on driving customer success and revenue growth, ensuri...
medicaresalesservicemedicaidcustomerbusinessdevelopmentoversightprocessimprovement

Chief Talent Officer
SPENTO PAPERS (INDIA) LLP 25.00 to 0.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Itanagar 01 Apr, 2025

We are looking for a Chief Talent Officer who will support our talent acquisition and development activities. You will implement regular performance evaluations and be in charge of our employees...
engagementeeosystemhrispayrolldevelopmentorganizationplanningemployeesuccessionexcellentworkforceinterpersonalstrategic

Business Development Manager
ADITYA BIRLA SUN LIFE INSURANCE COMPANY LIMITED 1.00 to 2.00 Years Gurugram,Delhi, Faridabad, Ghaziabad 01 Apr, 2025

Designation:Agency Manager Education:Any Graduates Experience:Fresher with Good network / Min. 1 Yearin anyDomain Sal...
salesinsuranceagency channelbfsi sales

Brand Manager
MNR Solutions Pvt Ltd 10.00 to 16.00 Years Gurugram 01 Apr, 2025

Brand Manager Key Responsibilities: Develop and execute comprehensive brand strategies and marketing plans, collaborating with the founders to drive brand growth and strengthen market presence...
brand managementbrand marketingbrand planningbrand campaigns

Plant Engineer
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 12.00 to 22.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Nellore, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

We are looking for a Plant Manager to drive continuous improvement and optimization of all processes.
Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla...
project engineeringprocess equipmentengineering processengineeringplant engineering

NTT DATA Virtual Drive Hedge Fund Gurgaon
NTT DATA INFORMATION PROCESSING SERVICES PRIVATE LIMITED 1.00 to 3.00 Years Gurugram 01 Apr, 2025

NTT DATA is Hiring experienced candidates for Hedge Fund Accounting domain. Location:Gurgaon Sector 48 (Candor Techspace) Work from Office Only Shift ...
reconciliationhedge fundsnav calculationinvestment banking

Area Sales Manager
SARANSH BIO ORGANIC PRIVATE LIMITED 1.00 to 5.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 01 Apr, 2025

Visit Doctors and other healthcare professional to promote, sell & demonstrate the Lifestyle healthcare Products

Identifying prospective business opportunities for the company....
business developmentpharmaceutical salesarea sales managementayurvedic medicine

Business Development Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 8.00 to 12.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 01 Apr, 2025

Key Responsibilities:

Strategic Planning: Develop and execute strategic business development plans that align with company goals and target ma...
sales growthanalysismarket analysisadaptabilityadministration workmarketcommunicationstrategic planningstrategic thinkinginnovationnegotiationcontractsresearch

Need Freelancer - Data Entry Operator - Work At Home, Apply Now
VISHWANATH ENTERPRISES 0.00 to 2.00 Years Ernakulam,Thrissur, Chennai, Hyderabad, Vishakhapatnam, Kolkata, Pune, Chandigarh, Hubli, Bhopal 01 Apr, 2025

Dear candidate, We are looking for freshers and experienced candidates for work from home We are offering a Job Part Time Jobs Data Entry Work Online Computer Work Work From Home Back Office Ex...
typing speeddata entrywriting skillspart time

Procurement Assistant
SHARMA ENTERPRISES 1.00 to 6.00 Years Ernakulam,Kochi, Kozhikode, Malappuram, Thrissur, Gwalior, Indore, Bokaro, Ranchi, Bhopal 01 Apr, 2025

We are currently searching for a Procurement Assistant supports the purchasing and supply chain processes, assisting with tasks like sourcing suppliers, preparing purchase orders, maintaining pro...
purchase operationssupplier quality assurancesourcing materialsinventory managementrecord maintenancedata analysisrecord keeping

Team Coordinator
SHARMA ENTERPRISES 4.00 to 9.00 Years Ernakulam,Idukki, Kannur, Kasargod, Kochi, Kollam, Kottayam, Kozhikode, Thrissur, Wayanad 01 Apr, 2025

We are looking for a result-driven team leader to be responsible for monitoring and supervising a team of consultants to achieve the organizations objectives and increase sales. You will be respo...
navigationanalysisconflict preventioncommunication skillsproblem solvingleadership managementmanagement reportingcontrolreportingtask completionorganizational administration

Product Manager
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 15.00 to 25.00 Years Ernakulam,Wayanad, Pala, Thiruvananthapuram, Gwalior, Indore, Jabalpur, Bhopal, Ratlam, Sagar 01 Apr, 2025

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c...
product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing

Field Marketing Manager
LEADERS GROUP 2.00 to 6.00 Years Kannur,Other Kerala 01 Apr, 2025

Were Hiring: Field Marketing Manager Are you a results-driven marketer who loves on-ground activations and outreach Join our team as a Field Marketing Manager and lead impactful marketing campai...
Offline MarketingEvent ManagementBrand AwarenessLead GenerationTeam ManagementCampaign AnalysisCommunication SkillsRelationship BuildingSponsorship ManagementPartnership BuildingBTL ActivitiesDatadriven

E2E CNX Architect / CNX Solution Architect
Infosys Limited 4.00 to 8.00 Years Other Kerala,Thiruvananthapuram 01 Apr, 2025

Key Responsibilities: A day in the life of an Infoscion As part of the Infosys consulting team your primary role would be to lead the engagement effort of providing high quality and value adding...
AWSDevOpsGoogle Cloud PlatformKubernetesTelecomSDLCAgile MethodologiesProject ManagementTeam ManagementAgile CoachBusiness Analyst

Creative Strategist
Samagra Progressive Learning Solutions Pvt Ltd 2.00 to 6.00 Years Kochi,Other Kerala 01 Apr, 2025

Samagra Progressive Learning Solutions Private Ltd is the brainchild of Madhu Bhaskaran, a renowned Business Strategist and HRD trainer. We aim to create a sense of total revamping in the lives of...
Market ResearchContent CreationCommunity EngagementCampaign ManagementBrand AwarenessLead GenerationVideo ProductionSocial Media StrategySocial Media Analytics

PREV
NEXT

people engagement activities Job Openings

Greeting from Malabar!

Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla... project engineeringprocess equipmentengineering processengineeringplant engineering

Description Job Requirements Job Title Collection Manager-BIL, Personal Loan and MBL Functio... collections processcollection strategyrecovery managementconsumer debtcollection managementcollection systemsdebt collection

Key Responsibilities:

Job Description / Responsibilities:

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c... product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing

Key Responsibilities: field salesgold valuationgold loan operationsgold loanbfsi salesrelationship managerrelationship officersales manager

About Us:

Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla... project engineeringprocess equipmentengineering processengineeringplant engineering

Key Responsibilities:

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c... product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla...
project engineeringprocess equipmentengineering processengineeringplant engineering

Description Job Requirements Job Title Collection Manager-BIL, Personal Loan and MBL Functio...
collections processcollection strategyrecovery managementconsumer debtcollection managementcollection systemsdebt collection

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c...
product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing

Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla...
project engineeringprocess equipmentengineering processengineeringplant engineering

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c...
product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing