project accounting jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

project accounting Job Openings

Showing 12551 - 12600 of 37987 Jobs

Full Stack Developer

LTIMindtree Limited 6.00 to 10.00 Years Hyderabad,Noida 01 Apr, 2025

sdlc

java

aws

Automation Testing

Srijan Spectrum Pvt Ltd 8.00 to 13.00 Years Hyderabad,Bangalore, Noida, Chennai, Gurugram, Kolkata, Pune, Mumbai City, Delhi 01 Apr, 2025

ui testinguat

Sr. Solar Sales Specialist
Jobs Territory 1.00 to 5.00 Years Gwalior,Ongole, Tirupati, Vijayawada, Hyderabad, Vishakhapatnam, Other Uttar Pradesh 01 Apr, 2025

Roles and responsibilities: Responsible for meeting Monthly Sales targets of Solar PV systems for Residential clients. Lead Generation - Ensure that all marketing leads being assigned are foll...
salesnetworkingnegotiationrelationship managementgoodlead generationsolarskills

Urgent Hiring for Field sales executive for Hyderabad, Prayagraj , Visakhap
Jobs Territory 1.00 to 4.00 Years Gwalior,Ongole, Tirupati, Hyderabad, Other Andhra Pradesh, Vijayawada, Vishakhapatnam 01 Apr, 2025

Sr. Solar Sales Specialist Roles and responsibilities: Responsible for meeting Monthly Sales targets of Solar PV systems for Residential clients. Lead Generation - Ensure that all marketing le...
solar energysalesfield sales

Civil Engineer
Divya Staffing Solution 0.00 to 4.00 Years Gwalior,Ujjain, Indore, Bhopal, Katni, Balaghat, Sagar, Jabalpur, Rewa, Kuwait, United Arab Emirates 01 Apr, 2025

Civil Engineers plan, design, manage, and construct a range of infrastructure, including roads, railways, bridges, airports, mines, buildings, dams, water systems, and several more. They analyse ...
budgetingtechnicalschedulinganalysis

Site Engneer ( MES Project)
Rama Infotech Private Limited 2.00 to 5.00 Years Gwalior,Agra, Bareilly, Gorakhpur, Bangalore, Noida, Ghaziabad, Lucknow, Allahabad 01 Apr, 2025

The site engineers will be responsible for the tasks : 1- Installation Supervision 2- Progress tracking and Reporting 3-Quality Assurance 4- coordination with stakeholders 5- Safety Complia...
problemtechnicalsoftsolvingskills

Pipeline Engineer
Garima Interprises 1.00 to 6.00 Years Gurugram,Delhi, Noida, Australia, Austria, Canada, Other AndamanNicobar, Port Blair, Bangalore, Chen 01 Apr, 2025

Pipeline Engineer Job Description Template We are looking for a highly experienced pipeline engineer to design and develop a variety of pipeline...
budgetingblueprintcommunicationrepairconstruction technologytechnical standards

Junior Engineer
Cynosure Corporate Solutions 2.00 to 5.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

ROLES AND RESPONSIBILITIES: Travel to allotted project site location for site survey, At site observe and report:

Measure the boundary of the site with use Googleapp....
equipmentsurveydatamappingsitehandlingcollectionsurveyinginspection

Design Manager
SHARMA ENTERPRISES 3.00 to 8.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Guwahati 01 Apr, 2025

We are currently searching for Design Manager oversees and coordinates the creative process of design projects, ensuring designs align with business goals, client needs, and project timelines, wh...
design patternsstrategic planningtechnical documentationsupervisory skills

Urgent hiring for site supervisor
AASAANJOBS PRIVATE LIMITED Hiring For AASAANJOBS PRIVATE LIMITED 1.00 to 5.00 Years Gurugram,Delhi, Noida, Jaipur, Meerut 01 Apr, 2025

Urgent hiring for Project Executive or Site Supervisor Job Location:- gurgaon, delhi, noida jaipur .kolkata ,meerut Salary:- Up to 22k ESI/PF TA Incentive
design managementproject coordinationproject management

Sr.Finance Manager
Confidential 10.00 to 15.00 Years Gurugram 01 Apr, 2025

We are Hiring for Senior Finance Manager - SahiBandhu FinTech Services ( The Manipal Group) About Us:- SahiBandhu is Indias leading gold loan platform backed b...
gaapbenefits realisationcash flowrisk managementfinancial analysiserpfinancial reportingstakeholder managementerp software

Sr. Electrical Design Engineer
JustHR 8.00 to 13.00 Years Gurugram 01 Apr, 2025

Role: Electrical Engineer Location: Gurgaon, India Profession/Role type: Engineering/Individual Contributor Employment type: Full-Time About us Wearecreating a platform for passionate engineer...
powerautocadbuildingdistributiondesignetapengineerelectrical

Accountant
PLACEMENT EXPERT Hiring For Congo DRC 4.00 to 9.00 Years Gurugram,Delhi, Bangalore, Chennai, Hyderabad, Vijayawada, Pune, Mumbai City 01 Apr, 2025

We have a requirement for Accountant with our client which Internet service provider in Kinshasa, Democratic Republic of the Congo. Position: Accountant englishaccounting

Video Editor - Advertising Agnecy
MEGMA SERVICES 2.00 to 4.00 Years Gurugram 01 Apr, 2025

ob description

Responsible for managing multiple video projects simultaneously. This includes understanding project requirements, establishing timelines and deadlines....
adobe premiere pro2d animationadobe photoshopmotion graphicsadobe after effectscameravideoadobe illustratortrackingeditor

Hvac Design Engineer
JustHR 14.00 to 20.00 Years Gurugram 01 Apr, 2025

Role: Lead/Principal Mechanical Engineer - HVAC Design Location: Gurgaon, India Profession/Role type: Engineering/Individual Contributor Employment type: Full-Time About us We arecreating a p...
designplumbingmepbimhvacrevitsystem

Marketing Executive
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Bhagalpur, Hyderabad, Pune, Patna, Guwahati 01 Apr, 2025

Marketing executives coordinate and oversee campaigns geared at promoting products, services, and causes. Marketing executives are adept at a variety of platforms, including print and social med...
marketing researchmarketing communicationmarketing managementbrand managementmarketing

Purchasing Assistant
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 12.00 to 22.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Panaji 01 Apr, 2025

Job brief We are seeking a detail-oriented Purchasing Assistant to join our team. Your main responsibility will be to order supplies and equipment in accordance with our companys needs. This...
purchasepurchase requisitionengineeringengineering designengineering managementproject engineeringpurchase management

Hiring For Online Marketing Executive (Work From Home Or Office Both) DELHI-NCR
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 01 Apr, 2025

Dear Candidate Greetings fromDesnor Destination Pvt Ltd ! Job Summary Idealises Internet Marketing Agency is looking for Marketing Executive to join our dynamic team and embark on a rewarding...
marketing planningdigitaldisplay advertisingmarketingfreelancingwork from homemarketing communicationpart time

Accounting Specialist
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 3.00 to 7.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 01 Apr, 2025

Check figures, postings, and documents for accuracy. Organize, secure, and maintain all files, records, cash and cash equivalents in accordance with policies and procedures. Record, store, access...
qualitystandardsbillingaccountingfinance executivementorsupervisorpayrollfinancial

Full Stack Developer
LTIMindtree Limited 6.00 to 10.00 Years Noida,Hyderabad 01 Apr, 2025

Job Description Develop maintain enhance and test client systems of moderate to high complexity Execute full software development life cycle SDLC build highquality innovative and performing sof...
sdlcjavaaws

Python API -Developer
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 2.00 to 6.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

Represent API Support with project teams to ensure that API knowledge is provided, thus ensuring effective support for new products and enhancements

Grow an up-to-date knowledg...
data visualizationgitlanguagecssapplication developmentpythonjavascriptchange managementdata structureshyperanalyticshtmlmarkup

Management Representative
ALTSEO PRIVATE LIMITED 15.00 to 25.00 Years Gurugram,Delhi, Bangalore, Chennai, Bhagalpur, Hyderabad, Kolkata, Mumbai City, Anantpur, Ahmedabad 01 Apr, 2025

Managers ensure that their assigned department, store, or district is well staffed and provisioned, adheres to quality and service standards, increases revenue and market share, and helps the bus...
qualitycollaborationdecision-makingmanagementcommunicationleadershipproblemsolvingdelegationproject

Plant Engineer
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 12.00 to 22.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Nellore, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

We are looking for a Plant Manager to drive continuous improvement and optimization of all processes.
Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla...
project engineeringprocess equipmentengineering processengineeringplant engineering

Business Associate
ALTSEO PRIVATE LIMITED 15.00 to 25.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

We are looking for an energetic business development associate to help drive our sales and grow the business. You will attract new clients and build solid relationships with them while maintainin...
visualizationsalesservicemanagementmarketingterminologycommunicationcustomerprojectmedicalstatementsskills

NTT DATA Virtual Drive Hedge Fund Gurgaon
NTT DATA INFORMATION PROCESSING SERVICES PRIVATE LIMITED 1.00 to 3.00 Years Gurugram 01 Apr, 2025

NTT DATA is Hiring experienced candidates for Hedge Fund Accounting domain. Location:Gurgaon Sector 48 (Candor Techspace) Work from Office Only Shift ...
reconciliationhedge fundsnav calculationinvestment banking

Project Supervisor
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 10.00 to 18.00 Years Thiruvanananthapuram,Bangalore, Chennai, Noida, Hyderabad, Kolkata, Gurugram, Agartala, Mumbai City, 01 Apr, 2025

We are looking for a responsibleSupervisorto oversee the workflow at our facilities. The role is acomplex one. He/She will not just be someone who supervises the work of others. ...
project managementtechnical skillscontract managementconstruction managementquality assurance

3D Visualizer
ED Group Pvt Ltd 1.00 to 5.00 Years Kochi,Other Kerala 01 Apr, 2025

We are hiring! Position: 3D Visualizer Experience: 1-2 years** Location: Kochi, Kerala Only apply if you are proficient using Sketchup, Lumion and D5 Render.* Key Responsibilities: Create hig...
SketchupLumionAutoCAD

Junior IoT Hardware and Firsm ware Developer @Amritapuri
Amrita Vishwa Vidyapeetham 2.00 to 6.00 Years Kollam,Other Kerala 01 Apr, 2025

Job Title Junior IoT Hardware And Firsm ware Developer Required Number 1 Qualification B.Tech, Good to have M.Tech but not a must to have requirement Job Description Tranquility IoT & Big Data Sol...
Electronics design skillsknowledgeKnowhow of embedded codingAbility to think out of the box

E2E CNX Architect / CNX Solution Architect
Infosys Limited 4.00 to 8.00 Years Other Kerala,Thiruvananthapuram 01 Apr, 2025

Key Responsibilities: A day in the life of an Infoscion As part of the Infosys consulting team your primary role would be to lead the engagement effort of providing high quality and value adding...
AWSDevOpsGoogle Cloud PlatformKubernetesTelecomSDLCAgile MethodologiesProject ManagementTeam ManagementAgile CoachBusiness Analyst

Operation Manager
digibiz build on quality rating pvt ltd 5.00 to 9.00 Years Kozhikode,Other Kerala 01 Apr, 2025

1. Project Management: - Plan, organize, and execute construction projects from initiation to completion. - Coordinate with District managers to ensure timely delivery within budgetary constrain...
Project ManagementResource ManagementQuality AssuranceTeam Leadership

Graphic Designer
Thought Factory Design 2.00 to 6.00 Years Kochi,Other Kerala 01 Apr, 2025

The ideal candidate is a creative team player, talented at visualisation and an Adobe software expert. You will be responsible for developing marketing and communications content that will separat...
marketingcontent developmentpresentation skillsAdobe IllustratorAdobe PhotoshopvisualisationAdobe softwarecommunications

Sr DOTNET Developer (MVC)
TPHRC PVT LTD 7.00 to 11.00 Years Other Kerala,Thiruvananthapuram 01 Apr, 2025

Experience: 7-8 Years Minimum Location: Trivandrum Mode Of work: On Site Responsibilities: Build and maintain application functionality for new and existing systems using the .Net toolset with...
Entity FrameworkSQL ServerHTMLCSSJavaScriptjQueryMVC FrameworkWeb servicesXMLASPNETASPNET CoreEntity Framework CoreREST Web APIs

Technical Content Writer ( 1 year Exp. )
Zennode Technologies 1.00 to 5.00 Years Kozhikode,Other Kerala 01 Apr, 2025

Calicut As an ideal candidate, you should have proven experience in a highly technical field, such as software development, computer science, or engineering. Your ability to evaluate and analyze ...
software developmentcomputer scienceengineeringwritten communicationverbal communicationuser experience designUI design

Financial Controller
GF HOTELS AND RESORTS 10.00 to 14.00 Years Other Kerala 01 Apr, 2025

Responsibilities Maintaining internal controls over financial reporting Presenting financial reports to an executive team Overseeing the preparation of budgets Managing accounting records Eva...
Financial reportingBudget preparationRisk managementRegulatory complianceFinancial statementsFinancial reportsAccounting records managementFinancial data analysisAuditing processes coordination

Divisional Manager
TEAMWORK CABLES PRIVATE LIMITED 16.00 to 25.00 Years Kannur,Kasargod, Kottayam, Kozhikode, Malappuram, Thiruvanananthapuram, Bangalore, Chennai, Mangalor 01 Apr, 2025

The Division Manager plays a vital role in overseeing and managing the operations of an entire division within the company. This position requires a blend of strategic oversight, operational manag...
foreign assistanceindustrial policymanagerial economicstrade negotiationoperating agreementsindustrial economicstrade agreementsdivision ordersmanager

Finance Administration Analyst
ASSETCARE SERVICES PRIVATE LIMITED 1.00 to 5.00 Years Kottayam,Bangalore, Chennai, Ghaziabad, Hyderabad, Kolkata, Gurugram, Faridabad, Mangalore, Ahmedaba 01 Apr, 2025

Financial Management Analysts examine budget estimates for completeness, accuracy, and conformance with procedures and regulations. Analyze budgeting and accounting reports. Afinancial analyst tr...
analysissoftwareaccountingdataexcelcommunicationcollaborationmodelingspreadsheetfinancialmathematical

Chemical Engineer
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 10.00 to 18.00 Years Thiruvanananthapuram,Bangalore, Chennai, Hyderabad, Gurugram, Kolkata, Mumbai City, Delhi, Other Kar 01 Apr, 2025

We are looking for a creative, cooperative chemical engineer with a wealth of technical and industry knowledge and a talent for process optimization. The chemical engineer will work in the office...
communication skillscreativityanalytical skillsproblem-solving skills

Urgent hiring for site supervisor
AASAANJOBS PRIVATE LIMITED Hiring For AASAANJOBS PRIVATE LIMITED 1.00 to 5.00 Years Delhi,Noida, Jaipur, Gurugram, Meerut 01 Apr, 2025

Urgent hiring for Project Executive or Site Supervisor Job Location:- gurgaon, delhi, noida jaipur .kolkata ,meerut Salary:- Up to 22k ESI/PF TA Incentive
design managementproject coordinationproject management

Regional sales director- Reasl estate and project sales
MEGMA SERVICES 10.00 to 20.00 Years Delhi,Noida, Gurugram 01 Apr, 2025

Leading Engineering and construction company requires Regional sales Director( Real estate) - Dehi/ Gurugram/Noida We are looking out for Regional sales director ( Real estate and Project sales)...
project salesdirector salesregional sales manager

Administrative Manager
Institute of Selection 5.00 to 10.00 Years Delhi,Mathura, Agra 01 Apr, 2025

Job Title: Assistant ADMIN Manager Location: Chhata, Mathura Department: P&&A Reports To: P&&A Manager Salary: INR 30,000/- to 50,000/- Job Summary The Admin Manager is responsible for overseeing...
budgetprocurementnegotiationpricing strategycoordination

Structural Engineer
LEADZN PRIVATE LIMITED 10.00 to 20.00 Years Delhi,Noida, Zimbabwe, Mozambique, Afghanistan, Bangalore, Chennai, Hyderabad, Gurugram, Kolkata, Pu 01 Apr, 2025

We are seeking a skilled and experienced structural engineer to join our team and take charge of overseeing our construction projects. Your primary responsibility will be to ensure the safety and...
architecturecommunicationanalyticalengineeringdesignproblemmanagementstructuralsolvingprojectcollaborateability

Mechanical Engineer
ATOVITT SERVICES PRIVATE LIMITED 4.00 to 9.00 Years Delhi,Noida, Ethiopia, Bangladesh, Anantpur, Bangalore, Chennai, Hyderabad, Kolkata, Gurugram, Pune, 01 Apr, 2025

We are looking for a creative Mechanical Engineer to work on all product stages from research and development to design and manufacture, through to installation and final commissioning.The goal i...
thermodynamicsoptimizationfluid mechanicstroubleshootingmachine designadaptabilitystructural analysisquality assurancematerial science

Management Representative
ALTSEO PRIVATE LIMITED 15.00 to 25.00 Years Delhi,Bangalore, Chennai, Bhagalpur, Hyderabad, Kolkata, Gurugram, Mumbai City, Anantpur, Ahmedabad 01 Apr, 2025

Managers ensure that their assigned department, store, or district is well staffed and provisioned, adheres to quality and service standards, increases revenue and market share, and helps the bus...
qualitycollaborationdecision-makingmanagementcommunicationleadershipproblemsolvingdelegationproject

Plant Engineer
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 12.00 to 22.00 Years Delhi,Noida, Bangalore, Chennai, Nellore, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City 01 Apr, 2025

We are looking for a Plant Manager to drive continuous improvement and optimization of all processes.
Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla...
project engineeringprocess equipmentengineering processengineeringplant engineering

Engineering Executive
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 11.00 to 21.00 Years Delhi,Faridabad, Noida, Bhagalpur, Chandigarh, Bhillai, Patna, Muzzafarpur, Korba, Ahmedabad 01 Apr, 2025

We are seeking a highly skilled and experienced Engineering Manager to join our team. In this role, you will be responsible for leading and coordinating multiple projects across diverse teams. Yo...
engineeringground improvementconstruction engineeringpavement engineeringearned value management

Business Associate
ALTSEO PRIVATE LIMITED 15.00 to 25.00 Years Delhi,Noida, Bangalore, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City 01 Apr, 2025

We are looking for an energetic business development associate to help drive our sales and grow the business. You will attract new clients and build solid relationships with them while maintainin...
visualizationsalesservicemanagementmarketingterminologycommunicationcustomerprojectmedicalstatementsskills

Urgent Opening- Financial Planning & Analyst- Manufacturing Industry- Delhi
Topgear Consultants Private Limited 2.00 to 7.00 Years Delhi 01 Apr, 2025

Hiring with a leading Manufacturing industry for their office in Delhi. Role: Financial planning & Analysis Qualification - MBA/CA Location: Delhi analysisfinancial planningbudgetingplanningvariance analysisforecastingmodelling

Senior Interior Designer
Gurjot Shan Designs 5.00 to 9.00 Years Chandigarh 01 Apr, 2025

Role Description This is a full-time on-site role for a Senior Interior Designer at Gurjot Shan Designs located in Chandigarh. The Senior Interior Designer will be responsible for space planning,...
Space PlanningArchitectureConstruction DrawingsInterior DesignProject ManagementClient CommunicationAutoCADSketchUpAdobe Creative SuiteBuilding CodesRegulations

Operations Manager - Immigration
IMygrate 2.00 to 6.00 Years Chandigarh 01 Apr, 2025

At IMygrate , we help individuals and families navigate the complex journey of Canadian immigration. With offices in Canada and India, we are known for our client-first approach, transparent proce...
Operations ManagementTeam ManagementCommunication SkillsProject ManagementOrganizational SkillsTechsavvy

Senior Architect
Rajdeep and Company Infrastructure Pvt Ltd 3.00 to 7.00 Years Chandigarh 01 Apr, 2025

Key Responsibilities: 1. Design and Planning: Develop architectural designs and plans for various projects including residential, commercial, and industrial structures. Conduct feasibility stud...
Technical SkillsProject ManagementCommunication

PREV
NEXT

project accounting Job Openings

Pipeline Engineer Job Description Template We are looking for a highly experienced pipeline engineer to design and develop a variety of pipeline... budgetingblueprintcommunicationrepairconstruction technologytechnical standards

Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla... project engineeringprocess equipmentengineering processengineeringplant engineering

Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla... project engineeringprocess equipmentengineering processengineeringplant engineering

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Pipeline Engineer Job Description Template We are looking for a highly experienced pipeline engineer to design and develop a variety of pipeline...
budgetingblueprintcommunicationrepairconstruction technologytechnical standards

Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla...
project engineeringprocess equipmentengineering processengineeringplant engineering

Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla...
project engineeringprocess equipmentengineering processengineeringplant engineering