visual effects creation Jobs

Experience: Min. 1 year Qualification: Graduation in any Field Job Location: Ludhiana (only local) Salary: 15-...

Our Company Changing the world through digital experiences is what Adobes all about. We give everyonefrom emerging artists to global brandseverything they need to design and deliver ...

Uniphore is one of the largest B2B AI-native companiesdecades-proven, built-for-scale and designed for the enterprise. The company drives business outcomes, across multiple industry...

Front end - Plain ASP.net with VB, Back end – SQL or Oracle MVC, JQuery, Javascript Domain-Banking / Finance / Insurance Roles & Responsibilities 1. Must develop code in plain ASP.net 2. Must have wor...

Company Overview Incedo is a US-based consulting, data science, and technology services firm with over 3000 people helping clients from our six offices across the US, Mexico, and Ind...

Wipro Limited Wipro Limited (NYSE: WIT, BSE: 507685, NSE: WIPRO) is a leading technology services and consulting company focused on building innovative solutions that address clients...

Wipro Limited (NYSE: WIT, BSE: 507685, NSE: WIPRO) is a leading technology services and consulting company focused on building innovative solutions that address cli...

Wipro Limited Wipro Limited (NYSE: WIT, BSE: 507685, NSE: WIPRO) is a leading technology services and consulting company focused on building innovative solutions that address clients...

AWS Utility Computing (UC) provides product innovations from foundational services such as Amazons Simple Storage Service (S3) and Amazon Elastic Compute Cloud (EC2), to consistent...

At Amazon, were working to be the most customer-centric company on earth. To get there, we need exceptionally talented, bright, and driven people. Over 2 million Sellers in 10 count...

Geosys Enterprise Solutions Pvt Ltd.(Geosys) is an ISO 9001:2015 certified company which has been recognised as one of the 20 Most Promising GIS Solution Providers in 2017 in India by CIOReview. Since...

Geosys Enterprise Solutions Pvt Ltd.(Geosys) is an ISO 9001:2015 certified company which has been recognised as one of the 20 Most Promising GIS Solution Providers in 2017 in India by CIOReview. Since...

Hello, We have opening forWordPress & Creative Designer for Gurugram Location . Job Title: WordPress & Creative Designer Location: Gurugram Compensation: Up to 5.5 LPA Working Hours: 12:00 P...
web designingvideo editinggraphic designingwordpress

Key Responsibilities:
1. Strategic Planning & Leadership:
   • Develop and execute presales strategies aligned with the companys sales goals. managementmarketsales acumendesigningpresentationanalysisleadershipproject managementtechnical expertiseteamsolution

Key Responsibilities:
• Develop and design engaging graphics for digital and print media, including brochures, flyers, advertisements, social media posts, and website co...
  illustratorgraphic designadobe photoshopdesigncreative ability

Key Responsibilities:
• Develop and design engaging graphics for digital and print media, including brochures, flyers, advertisements, social media posts, and website co...
  illustratorgraphic designadobe photoshopdesigncreative ability

Dear Candidate Greetings fromDesnor Destination Pvt Ltd ! Job Summary Idealises Internet Marketing Agency is looking for Marketing Executive to join our dynamic team and embark on a rewarding...
marketing planningdigitaldisplay advertisingmarketingfreelancingwork from homemarketing communicationpart time

Key Responsibilities:
• Develop and design engaging graphics for digital and print media, including brochures, flyers, advertisements, social media posts, and website co...
  illustratorgraphic designadobe photoshopdesigncreative ability

IMMEDIATE JOINERS OR NOTICE PERIOD WITH 30-45 DAYS ARE REQUIRED. ROLES AND RESPONSIBILITIES;
1. OICVBCS
• Need 6 y...
  bipvbcs

Key Responsibilities:
• Develop and design engaging graphics for digital and print media, including brochures, flyers, advertisements, social media posts, and website co...
  illustratorgraphic designadobe photoshopdesigncreative ability

Updated NPD Engineer Location: Ludhiana Salary: 30,000-35,000 Qualification: Diploma or B.Tech. in Mechanical Engineering Experience: Minimum 3 years Candidate must have experience of CAPA, APQ...
CAPAAPQPPPAPFMEA

Company Description Ganga Acrowools Limited, located in Ludhiana, is a renowned manufacturer and exporter of Acrylic Yarns with over 60 years of experience in the industry. The company prides its...
HRISIT security best practicesData analysisReportingLMS platformsData encryptionSystem integrationsMobile app developmentProject management toolsAIbased tools

Job Responsibilities (List in order of importance) Store Operations: Oversee daily operations, including opening and closing procedures, cash handling, and compliance with company policies and pr...
store operationsstore management

Role Description This is a full-time on-site role for a Social Media Executive at Digihive in Lucknow. The role involves managing social media accounts, creating engaging content, analyzing metri...
social media managementcontent creationdigital marketingsocial media analytics

Job Summary: We are seeking a talented and detail-oriented Technical Content Writer to create, edit, and optimize high-quality technical documentation, manuals, blogs, and other content. The ideal...
Content CreationCollaborationContent OptimizationEditing

We are seeking a talented and detail-oriented Graphic Designer proficient in CorelDRAW and Photoshop. The ideal candidate will have hands-on experience working with laser machines and the ability ...
CorelDRAWPhotoshoppackaging designlaser machinesdigital graphicsillustrations

At Srijan Digital Arts, we believe that creativity has the power to transform ideas into extraordinary visual experiences. We are constantly on the lookout for talented individuals who share our p...
Illustration2D ArtDrawingSketchingColor TheoryAnatomyVisual CommunicationPerspective

Genpact (NYSE: G) is a global professional services and solutions firm delivering outcomes that shape the future. Our 125,000 people across 30 countries are driven by our innate curiosity, entrepr...
General AccountingJournal EntriesIntercompany AccountingInternal AuditExternal AuditSOX ComplianceMS ExcelERPMS OfficePartner ManagementProcess ImprovementMonth End CloseFixed Assets CapitalizationBank ReconciliationsGeneral Ledger Reconcili

As a Jewellery Designer at Rathod Jewellery Mfg. Pvt. Ltd., you will be responsible for creating innovative and aesthetically appealing jewellery designs that align with our brands vision. You w...
Design DevelopmentSketchingRenderingMaterial SelectionMarket ResearchCommunicationInterpersonal SkillsJewellery DesignPrototype CreationProduction Oversight

Were looking for a talented and versatile Content and Creative Writer who can craft engaging content in both English and Malayalam languages. As a key member of our content team, youll be responsi...
Content WritingCreative WritingEnglish LanguageResearchEditingProofreadingCommunication SkillsContent Management SystemsKeyword ResearchMalayalam LanguageSEO PrinciplesSocial Media Platforms

Are you passionate about creating dynamic visual stories through motion graphics and animation Join our team and make a lasting impact with your creative expertise! About Us At Koncepts Lab, we...
Motion Graphic DesignAnimationAdobe After Effects3D AnimationCinema 4DBlender

Experience 3 years. Job Purpose Be a senior engineer in Web development using Angular. Job Description Expertise in developing Angular based web applications with Web Services (REST) Excelle...
AngularWeb ServicesRESTXMLJSONCSSJavaScriptAJAXDOMgitNPMbootstrapPipesDirectivesdesign patternsREST APIGITHTMLXHTMLTypeScriptNodeJSExpressJSwebpackInterceptorsDecoratorsobjectoriented conceptsMVC design patternscode versioning to

We are looking for an ambitious and self-driven Front-end Developer to join our team. As a Front-end Developer, you will be responsible for implementing visual elements that users see and interac...
javascriptprogramminghtmldevelopment

Position Summary

We are seeking a Marketing Automation Speci...
salesforcemarketowordpresshubspotseopardot