arvr technologies jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

arvr technologies Job Openings

Showing 1351 - 1400 of 17253 Jobs

Service Engineer

CONCEPTS GLOBAL Fresher Vadodara, JaipurJaipur, Bangalore, Mumbai City 24 Sep, 2025

Position Overview We are seeking a dedicated and skilled Service Engineer to join our dynamic team. This role is essential in ensuring the optimal performance of our electron...
electronicslaminationphotocopiershreddersinstallation

JUNIOR JAVA DEVELOPER

Cueserve Fresher Vadodara, Gujarat 24 Sep, 2025

PHP & WordPress Developer

SEOWebPlanet Solutions - Digital Marketing Company in India Fresher Vadodara, Gujarat 24 Sep, 2025

Sales Co-ordinator

MecPower Solutions Pvt Ltd Fresher Vadodara, Gujarat 24 Sep, 2025

Web Content Writer

Tempsens Instruments (I) Pvt Ltd Fresher Udaipur, Rajasthan 24 Sep, 2025

Keyword research

Google Analytics

Written communication

Verbal communication

SEOoptimized technical content writing

Content marketing strategies

Content management systems CMS

Information Security Analyst - Vulnerability Management

Secure Meters Limited Fresher Udaipur, Rajasthan 24 Sep, 2025

Certified Ethical Hacker CEH

SQL Developer

FYNXT Fresher Surat, Gujarat 24 Sep, 2025

database normalization

ETL processes

cloudbased databases

big data technologies

PHP Laravel Developer

Webiots Technologies Fresher Surat, Gujarat 24 Sep, 2025

MERN Full Stack Developer

Xcellence-IT Fresher Surat, Gujarat 24 Sep, 2025

Version control systems

Agile development methodologies

TypeScript

GraphQL

CICD

Laravel Developer

Param Software Fresher Rajkot, Gujarat 24 Sep, 2025

Microservices Architecture

Laravel Livewire

Inertiajs

Machine Learning Engineer

Eyushion TechSol Pvt Ltd Fresher Rajkot, Gujarat 24 Sep, 2025

Tech Lead

Sterlite Technologies Limited Fresher Bhadrak 24 Sep, 2025

Functional specifications

Cost Center Accounting CCA

Profit Center Accounting PCA

Profitability Analysis CO

Sales Executive- Computer Showroom

Tanisha E- World Fresher Bhubaneswar 24 Sep, 2025

Sales

Computer Hardware

Customer Service

Relationship Building

Peripherals

Customer Consultation

presales consultant

BSH TECHNOLOGIES PRIVATE LIMITED Fresher Bhubaneswar 24 Sep, 2025

Work closely with the Business Development & Sales teams to support lead qualification and opportunity conversion.
Conduct r...
crmpresentationsclientsmbsoftwaresalestoolsexcelpowerpointdemosmarketproposalsstrongmandatory.knowledgesystems.serviceslikeestimationsusing

Product Manager for Dust Collection System

Spark & Ray Technocrats Private Limited Fresher Raipur 24 Sep, 2025

Mechanical Engineering

Instrumentation Engineering

Product Management

Dust Collection Systems

Dot Net Developer

RAJKAMAL BARSCAN SYSTEMS PVT LTD Fresher Patna, KolkataKolkata, Bangalore, Chennai, Noida, Hyderabad, Gurugram, Pune, Mumbai City, Delhi 24 Sep, 2025

Software Developer (.NET|.NET Core)

Technologies:...
mvc frameworkdesignproceduresdatabaseweb applications.net coremssqlstoredentity framework / ef corewindows applicationscustomer support / technical issue resolution.net developer

BHMS Fresher

ACHIEVERS SPOT Fresher Pondicherry, ChennaiChennai, Bangalore, Hyderabad 24 Sep, 2025

Job Description

nursing

bhms

nutrition

Dot Net Developer

Ariel Software Solutions Fresher Punjab 24 Sep, 2025

Entity Framework 6EF CoreNHibernateADONET

Depende

Magento 2 Developer

Sookshum Labs Technologies Private Limited Fresher Punjab 24 Sep, 2025

Magento Best Practices

Relational Database Systems

ObjectOriented Programming

ProblemSolving

Organizational Skills

GIT Version Control

Shopify Theme Developer

Akuna Technologies Fresher Mysore, Karnataka 24 Sep, 2025

Shopify App integrations

Web design standards

Digital marketing video and poster editing freshers 3 months unpaid internship

software development and graphic design Fresher Madurai, Tamil Nadu 24 Sep, 2025

Social Media Marketing

Creativity in visual content creation

Enthusiasm for learning

Adapting to new technologies

Solar PV Installation & Maintenance Trainer

DIDYU TECHNOLOGIES PRIVATE LIMITED Fresher Madurai, TiruchirappalliTiruchirappalli, Thanjavur, Erode, Coimbatore, Chennai, Salem, Sivakasi, Kri 24 Sep, 2025

Job Title:

Location:

solar pvstandardsmaintenanceinstallationprotocolssafetysolarsolar project field experience

Freelance Trainer - Python & Artificial Intelligence
DIDYU TECHNOLOGIES PRIVATE LIMITED Fresher Madurai, TiruchirappalliTiruchirappalli, Erode, Coimbatore, Chennai, Thirunelveli, Salem, Dindigul, 24 Sep, 2025

Job Title: Freelance Trainer - Python & Artificial Intelligence Job Location: Based upon Projects ( Inside Tamil Nadu) Job type: Freelance /on-site We are hiring an experien...
natural language processingpandamachine learningnumpyflowpythonscikit-learndeep learningartificial intelligence

Digital Marketing Specialist
Study Square Fresher Ludhiana, Punjab 24 Sep, 2025

Study Square is an international student placement consultancy providing comprehensive support to international students throughout their academic journey. From admission counseling to student vi...
SEOPPCSocial Media MarketingEmail MarketingContent MarketingDisplay AdvertisingGoogle AnalyticsAdWordsContent Management SystemsHTMLMarketing Automation Tools

Senior Front End Developer .NET
Milestone Technologies, Inc Fresher Kochi, Kerala 24 Sep, 2025

We are seeking a highly skilled Senior Front-End Developer who excels in constructing contemporary, responsive, and high-performance web applications. The ideal candidate possesses expertise in va...
JavaScriptHTML5CSS3AngularRESTful APIsnpmyarnAzure DevOpsGitDebuggingCommunicationCollaborationMicrosoft Razor UINET MVCTypeScriptReactVuejsNET CoreNET 6WebSocket integrationWebpackViteCICD pipelines

Junior Angular Developer
HighQ-Labs Pvt Ltd Fresher Kochi, Kerala 24 Sep, 2025

You will be responsible for developing and maintaining code in accordance with predefined cost, company, and security standards. Your role will involve working on bug fixes, supporting the mainten...
rest apiSQLMongoDBsoftware programmingHTMLCSSAngular 2Hibernate Java

B2B Sales Intern
Exogenous Technology Fresher Ranchi, Jharkhand 24 Sep, 2025

Exogenous Technology is a leading provider of comprehensive digital solutions for businesses of all sizes, from small enterprises to large corporations. With a wealth of experience spanning over 5...
Customer ServiceSalesSales ManagementTrainingInterpersonal SkillsStrong Communication

Hiring For Data Scientist
DEVIKA STAFFING SOLUTION Fresher Ranchi, PatnaPatna, Jammu, Dehradun, Mohali, Srinagar, Raipur, Navi Mumbai, Chandigarh, Vasco Da Gam 24 Sep, 2025

we rely on insightful data to power our systems and solutions. Were seeking an experienced data scientist to deliver insights on a daily basis. The ideal candidate will have mathematical and stat...
software testingtestingqualityhardware testing

Hiring For Mechanical Engineer
DEVIKA STAFFING SOLUTION Fresher Bokaro, DhanbadDhanbad, Ranchi, Odisha, Bhubaneswar, Nashik, Cuttack, Indore, Bhillai, Nagpur 24 Sep, 2025

You will be critical in planning, coordinating and executing mechanical projects, ensuring they meet technical specifications, budgets and established quality standards. You would also collaborat...
qualityproductionsupervision

Software Tester
Brightcode Software Services Fresher Ranchi, Jharkhand 24 Sep, 2025

As a Software Tester, you should possess a B.Tech (CS , IT) / BCA / MCA qualification and have 1 - 3 years of professional experience. Your responsibilities will include being strong in Database T...
Manual TestingDatabase testingSystem TestingBrowser TestingDefect ManagementAutomation Testing

Service Engineer
CONCEPTS GLOBAL Fresher Jaipur, BangaloreBangalore, Mumbai City, Vadodara 24 Sep, 2025

Position Overview We are seeking a dedicated and skilled Service Engineer to join our dynamic team. This role is essential in ensuring the optimal performance of our electron...
electronicslaminationphotocopiershreddersinstallation

.NET MVC Developer
Markstein Technology Solutions Fresher Gwalior, Madhya Pradesh 24 Sep, 2025

As an ASP.NET MVC developer at Markstein, you will have the opportunity to develop and support existing applications using optimal technologies and patterns. Your responsibilities will include des...
MS SQL ServerEntity FrameworkAngularJSJavascriptjQueryHTMLCSSSQL ServerOOPSAjaxWeb ServicesLinqNET MVCASPNET With CWeb API

Senior Java Developer
Delta Sys-Tech (India) Pvt Ltd Fresher Ahmedabad 24 Sep, 2025

Permanent job opening for Java Fullstack Developer with US MNC organization at Ahmedabad Job Description Years of experience 6 9 / 9 - 12 years spring bootjavastackangularjshibernatemicroservicescore javareact.jsdeveloper

Manager Research & Development (Agronomy)
McCain Foods Limited Fresher Mehsana, Gujarat 24 Sep, 2025

**** **Role Overview:** As the Manager Research & Development (Agronomy) at McCain in Mehsana, you will be responsible for new variety shortlisting, variety evaluation, and agronomic trials for ...
AgricultureHorticultureBreedingAgronomyApplied ScienceVariety TrialCrop Production

Frontend Developer - Reactjs
Webential Technologies Pvt Ltd Fresher Ahmedabad, Gujarat 24 Sep, 2025

As a Frontend Developer at Webential Technologies in Ahmedabad, you will be responsible for designing, developing, and implementing scalable web applications from front to back. You should have 2 ...
JavaScriptDOMGitReactjsNextjsHTML5CSSTypescriptBrowser EventsJavaScript APIsCanvas renderingBabelPostCSSWebpack

Senior Data Scientist
aloola Fresher Surat, Gujarat 24 Sep, 2025

We are looking for an experienced Senior Data Scientist to join our team at Aloola Solutions. As a Senior Data Scientist, you will be responsible for leveraging advanced analytics, machine learnin...
PythonR ProgrammingHadoopSparkTableauPower BISQLData ModelingMachine Learning AlgorithmsBig Data Technologies

Assistant Manager FMCG Company
sk online services Fresher Ahmedabad, Andhra PradeshAndhra Pradesh, Gujarat, Baddi, Bangalore, Kullu, Dharamshala, Dalhousie, B 24 Sep, 2025

Job description In case of any query, kindly connect on78,34,98,21,39 Rita Preference will be given to immediate joiners. We are looking for a skilled Assistant Manager t...
management skillsproduct trainingproject planningcustomer serviceinventoryteam leadingcommunication skillsproduct qualityleadership

Specialist I - SE - React , Typescript
UST Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

Role Overview: As a Lead Software Engineer within our enterprise product domain, you will play a pivotal role as both an expert individual contributor and a technical multiplier. You will be respo...
JavascriptReactJsNodeJs

Technical lead
Kalki Communication Technologies Fresher Kochi, Kerala 24 Sep, 2025

As a Technical Lead - Manual Testing, you will be responsible for leading a team of 4-6 members, preparing test plans, and developing test cases based on RTM. Your knowledge on IEC protocols, Linu...
Manual testingLinuxOracleSQL ServerMySQLTomcatJBossJIRABugzillaConfiguration ManagementWeb application testingIEC protocols

Fullstack Developer
PRIMATE CONSULTING SERVICES PRIVATE LIMITED Fresher Kochi 24 Sep, 2025

Required Skills & Qualifications 8 to 12 years of experience in software development with strong Java, Spring Boot expertise. Proven experience in designing microservices and distributed system...
javadeveloperspringboot

Senior Java/Fullstack Developer / Database Architect- KERLA
PRIMATE CONSULTING SERVICES PRIVATE LIMITED Fresher Ernakulam 24 Sep, 2025

Senior Java/Fullstack Developer / Technical Solution & Database Architect Job Summary We are seeking a highly experienced and technically sound Senior Java Developer who can take ownership as a...
javadatabase architecture

Software Developer (.Net)
BlueSeven Technologies LLC Fresher Kochi, Kerala 24 Sep, 2025

BlueSeven Technologies LLC, a Dubai based company owned by ATS Travel, a leading Travel Management Company with over 40 years of experience in providing comprehensive travel solutions to corporate...
NETSQL ServerWCFAngularJSJavaScriptjQueryOOPsMicrosoft SQL ServerGitASPNet MVCASPNet CoreWeb API

Technical Support Engineer
Ginger Technologies Fresher Thrissur, Kerala 24 Sep, 2025

As a Technical Support Engineer at Ginger Technologies, you will play a crucial role in providing technical assistance and support to our clients. Your responsibilities will include: - Utilizing ...
Technical SkillsTroubleshootingCustomer ServiceProblem SolvingExcellent Communication Skills

Research and Development Product Manager
First Screen Fresher Kochi, Kerala 24 Sep, 2025

As a Research and Development Product Manager at our company, you will play a crucial role in establishing and leading a new Research & Development unit. You will be responsible for bridging the g...
Team LeadershipProduct DevelopmentStakeholder ManagementAgile MethodologiesLeadershipProduct OwnershipSoftware Development ProcessesCloud TechnologiesEnglish CommunicationProblemSolving

Manager, Digital Services Sales/Sales Manager
Zyxware Technologies Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

As a Sales Manager at Zyxware Technologies, you will play a crucial role in driving revenue generation from the assigned geographies. Your responsibilities will include identifying potential new c...
Sales strategiesSales planningForecastingConsultative sellingClient account managementValue chain analysisTeam buildingRevenue generationRisk managementCommunication skillsPresentation skillsMarket understandingSales process design

Full stack Developer- Angular
SE Mentor Solutions Fresher Kochi, Kerala 24 Sep, 2025

As a Frontend Developer with expertise in Angular and API development, you will be responsible for the following: - Creating reusable components, custom directives, decorators, and services to in...
AngularAPI developmentdesign patternsJavaScriptHTMLCSSAzureHealthcareBootstrapAzure DevOpsGitlabJenkinsRoutingPipesLINQNGRXTypeScriptFront EndUIAzure AppsIonicMaterial UITyped FormsPromise vs ObservablesRxJs OperatorsTask vs Thre

Design Engineer AutoCAD & Solid Works (Civil)
Amensco Medical Technologies Pvt ltd Fresher Kerala 24 Sep, 2025

As a detail-oriented engineer, you will be responsible for preparing and reviewing detailed engineering drawings, 3D models, and layouts using AutoCAD and SolidWorks. You will also assist in the d...
AutoCADSolidWorksDesign calculationsAnalysisOptimizationComplianceDocumentation

Solar PV Installation & Maintenance Trainer
DIDYU TECHNOLOGIES PRIVATE LIMITED Fresher Erode, ThanjavurThanjavur, Madurai, Tiruchirappalli, Coimbatore, Chennai, Salem, Sivakasi, Krishnagi 24 Sep, 2025

Job Title: Solar PV Installation & Maintenance Trainer Location: Chennai solar pvstandardsmaintenanceinstallationprotocolssafetysolarsolar project field experience

Freelance Trainer - Python & Artificial Intelligence
DIDYU TECHNOLOGIES PRIVATE LIMITED Fresher Erode, MaduraiMadurai, Tiruchirappalli, Coimbatore, Chennai, Thirunelveli, Salem, Dindigul, Krishnag 24 Sep, 2025

Job Title: Freelance Trainer - Python & Artificial Intelligence Job Location: Based upon Projects ( Inside Tamil Nadu) Job type: Freelance /on-site We are hiring an experien...
natural language processingpandamachine learningnumpyflowpythonscikit-learndeep learningartificial intelligence

Python / Gen AI Developer
LION AND ELEPHANTS CONSULTANCY PRIVATE LIMITED Fresher Erode, CoimbatoreCoimbatore, Chennai, Tambaram, Pudukottai, Dindigul, Namakkal, Kumbakonam, Bangalor 24 Sep, 2025

Job Overview: We are looking for an experienced and passionate Python/Gen AI Developer to join our team in Coimbatore. The ideal candidate will have strong expe...
pythoncloud awsartificial intelligencedjangoflaskllmsgenerative ailanggraphpyspark

PREV
NEXT

arvr technologies Job Openings

Position Overview We are seeking a dedicated and skilled Service Engineer to join our dynamic team. This role is essential in ensuring the optimal performance of our electron... electronicslaminationphotocopiershreddersinstallation

Job Description

Position Overview We are seeking a dedicated and skilled Service Engineer to join our dynamic team. This role is essential in ensuring the optimal performance of our electron... electronicslaminationphotocopiershreddersinstallation

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Position Overview We are seeking a dedicated and skilled Service Engineer to join our dynamic team. This role is essential in ensuring the optimal performance of our electron...
electronicslaminationphotocopiershreddersinstallation

Position Overview We are seeking a dedicated and skilled Service Engineer to join our dynamic team. This role is essential in ensuring the optimal performance of our electron...
electronicslaminationphotocopiershreddersinstallation