fusion project portfolio management jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

fusion project portfolio management Job Openings

Showing 39351 - 39400 of 108031 Jobs

Profiles to be source-Agency Direct - in Life Insurance

ATS Infovision 2.00 to 7.00 Years Gurugram,Dehradun 01 Apr, 2025

Dear Candidates Greetings of the Day, We are the leading Job Consultancy for BFSI Sector and have tieup with almost all major life Insurance companies for recruitment...
life insurancebusiness developmentagency developmentagency channelassociate development

Data Entry Operator

V-Tech Data Outsourcing 0.00 to 1.00 Years Gurugram,Noida, Bangalore, Chennai, Hyderabad, Kolkata, Navi Mumbai, Thane, Pune, Mumbai City 01 Apr, 2025

Quick and accurate typing and word processing skills
Accuracy and attention to detail
Integrity, discretion, and respect for...
handwriting work from homeexcel sheetwork from homedata analyticswork from home typingwork from home content writingtyping

Pipeline Engineer
Garima Interprises 1.00 to 6.00 Years Gurugram,Delhi, Noida, Australia, Austria, Canada, Other AndamanNicobar, Port Blair, Bangalore, Chen 01 Apr, 2025

Pipeline Engineer Job Description Template We are looking for a highly experienced pipeline engineer to design and develop a variety of pipeline...
budgetingblueprintcommunicationrepairconstruction technologytechnical standards

Ppc Head. .
Institute of Selection 10.00 to 12.00 Years Gurugram,Delhi 01 Apr, 2025

Job Title: PPC Head Woven Fabrics Location: Gurugram Experience: 10 Years Industry: Textile / Woven Fabrics Manufacturing Salary: Negotiable Job Overview: we are a recruitment consultancy W...
ppcplanningproductionwoovenfabrics

Opening for Freelance Recruiter with Talentsphere Management Services
Reema Rai 1.00 to 6.00 Years Gurugram,Delhi, Noida, Bangalore, Kochi, Chennai, Hyderabad, Kolkata, Mumbai City, Mangalore 01 Apr, 2025

Greetings from Talentsphere Management Services! I hope youre doing well. We are excited to introduce a fantastic opportunity for you to collaborate with us a...
screening resumesexecutive searchfreelance recruitmentrecruitmentnon it recruitmenttechnical recruitingit recruitment

Junior Engineer
Cynosure Corporate Solutions 2.00 to 5.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

ROLES AND RESPONSIBILITIES: Travel to allotted project site location for site survey, At site observe and report:

Measure the boundary of the site with use Googleapp....
equipmentsurveydatamappingsitehandlingcollectionsurveyinginspection

Design Manager
SHARMA ENTERPRISES 3.00 to 8.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Guwahati 01 Apr, 2025

We are currently searching for Design Manager oversees and coordinates the creative process of design projects, ensuring designs align with business goals, client needs, and project timelines, wh...
design patternsstrategic planningtechnical documentationsupervisory skills

Cluster Head - ADRV Insurance Team Handling Profile Salary Upto 14Lac
Niyukti Management Consultants 10.00 to 17.00 Years Gurugram,Delhi, Noida, Lucknow, Pune, Mumbai City 01 Apr, 2025

We are currently hiring for a key position and would like to share the updated requirements with you. Kindly review the details below: Key Specifications:
insurance agency managementinsurance saleslocation headterritory managerbranch headbranch managerchief branch managerarea manager

Urgent hiring for site supervisor
AASAANJOBS PRIVATE LIMITED Hiring For AASAANJOBS PRIVATE LIMITED 1.00 to 5.00 Years Gurugram,Delhi, Noida, Jaipur, Meerut 01 Apr, 2025

Urgent hiring for Project Executive or Site Supervisor Job Location:- gurgaon, delhi, noida jaipur .kolkata ,meerut Salary:- Up to 22k ESI/PF TA Incentive
design managementproject coordinationproject management

Urgent | Hiring SME(Ticketing) & SME (Sales) in Delhi & Gurugram
Sharda Consultancy Services 1.00 to 6.00 Years Gurugram,Delhi, Faridabad, Noida 01 Apr, 2025

Dear Candidates, We are hiringSME(Ticketing) & SME (Sales) in Delhi & Gurugram SME (Ticketing) - Delhi Salary 40 k depending upon the interview SME (Sales) - Gurugram Salary 55k incentives Pr...
subject matter expertiseteam managementgdsamadeussalesprocesstravel coordinationtravelholiday packagesticketingsme

Retail Head Location- Gurugram
THE TALENT KEEPERS 10.00 to 20.00 Years Gurugram 01 Apr, 2025

Knowledge of handling multiple stores with P&L accountability.

Understanding of Fusion software including opening of item masters, vendor codes, PO generations, and other aspects upto ...
inventorysupervisionmanagementstoreretailoperation

Mechanical Supervisor
Xperts Manpower Solutions Enterprises Hiring For Japanese MNC Fresher Gurugram,Delhi, Faridabad, Noida 01 Apr, 2025

We have an urgent requirement of Be Mechanical candidates for production and quality profile in automobile industries for manufacturing units candidates should be the fresher which will be haired...
machine shopmachine assemblyquality engineeringmechanical maintenancemechanical engineeringassembly shopprocess inspectionproduction engineering

Sr.Finance Manager
Confidential 10.00 to 15.00 Years Gurugram 01 Apr, 2025

We are Hiring for Senior Finance Manager - SahiBandhu FinTech Services ( The Manipal Group) About Us:- SahiBandhu is Indias leading gold loan platform backed b...
gaapbenefits realisationcash flowrisk managementfinancial analysiserpfinancial reportingstakeholder managementerp software

Purchase Manager - Sec 43, Gurgaon ( Food Industry Experience )
Alpha Pro Services Hiring For Alpha Pro Services 1.00 to 6.00 Years Gurugram 01 Apr, 2025

Position - Purchase Manager - Male Location:Sec 43, Gurgaon Job Responsibilities :- Research potential vendors. Compare and evaluate offers f...
procurementvendor managementpurchasefood

Sr. Electrical Design Engineer
JustHR 8.00 to 13.00 Years Gurugram 01 Apr, 2025

Role: Electrical Engineer Location: Gurgaon, India Profession/Role type: Engineering/Individual Contributor Employment type: Full-Time About us Wearecreating a platform for passionate engineer...
powerautocadbuildingdistributiondesignetapengineerelectrical

Sr. Managing Partner APC Life Insurance Company salary upto 7Lac
Niyukti Management Consultants 6.00 to 11.00 Years Gurugram,Delhi, Faridabad, Noida, Karnal, Sirsa, Dehradun, Jaipur, Indore, Bhopal 01 Apr, 2025

Job Opening: Sr. Managing Partner APC Life Insurance Company Location: Delhi, Gurugram, Noida, Faridaba...
life insurancesalesunit managerbusiness development managerdeputy branch manager sourcingdevelopment managersales manageragency development managerbusiness manager

Urgent | Hiring for Admission Head for Corporate Pre school at Gurugram
HR Globe Recruitment Service 3.00 to 8.00 Years Gurugram 01 Apr, 2025

Dear Candidates, Urgent | Hiring for Admission Head for Corporate Pre school at Gurugram Salary upto 55k Interested candidates please call hr on hidden_mobile 1. Me...
parent communicationcounsellinglead generationpreschoolonline lead generation

Video Editor - Advertising Agnecy
MEGMA SERVICES 2.00 to 4.00 Years Gurugram 01 Apr, 2025

ob description

Responsible for managing multiple video projects simultaneously. This includes understanding project requirements, establishing timelines and deadlines....
adobe premiere pro2d animationadobe photoshopmotion graphicsadobe after effectscameravideoadobe illustratortrackingeditor

Business Development Manager
KKD Consulting Hiring For Clients 2.00 to 7.00 Years Gurugram,Faridabad, Ghaziabad, Noida, Panchkula, Mohali, Chandigarh, Mumbai City 01 Apr, 2025

KKD IS HIRING Job Title: Sales Manager - Agency Channel Company Overview: Join , a leading firm committed to innovation and excellence. Were ...
salesoutside sales

Sales Manager
Willpower Consultants Hiring For Axis Max Life Insurance 3.00 to 5.00 Years Gurugram,Delhi, Bangalore, Indore, Chennai, Kurnool, Ujjain, South Goa, North Goa 01 Apr, 2025

We are looking for a motivated Associate Agency Development Manager to support the recruitment, training, and growth of agency teams. The ideal cand...
marketingsales

Sr HRBP Associate -Gurugram
MEGMA SERVICES 3.00 to 6.00 Years Gurugram 01 Apr, 2025

Leading engineering and construction company requires Sr HRBP Associate - Gurugram One of our client luxury brand which is Indias leading manufacturer of premium doors, windows, wood house and t...
hr operationshrbpassociate

Freshers, Exp - Sales Associates - EV Charger Manufacturer
Avani Consulting 0.00 to 3.00 Years Gurugram 01 Apr, 2025

Greetings from Avani Consulting We are hiring for the below opportunity: Company: A leading EV charger manufacturer, revolutionizing the electric vehicle charging ecosystem. <...
sales coordinationchargerslithium-ion batteriesbattery

Hvac Design Engineer
JustHR 14.00 to 20.00 Years Gurugram 01 Apr, 2025

Role: Lead/Principal Mechanical Engineer - HVAC Design Location: Gurgaon, India Profession/Role type: Engineering/Individual Contributor Employment type: Full-Time About us We arecreating a p...
designplumbingmepbimhvacrevitsystem

Materials Manager
SHARMA ENTERPRISES 3.00 to 8.00 Years Gurugram,Faridabad, Bhiwani, Hisar, Karnal, Kurukshetra, Panchkula, Ambala, Panipat, Kolkata 01 Apr, 2025

We are searching for a qualified materials manager to oversee our inventory and purchasing operations. If you are an experienced and competent individual with in-depth knowledge of inventory mana...
inventory managementmaterials managementmaterial procurementsourcing strategylogistics managementmanufacturingpurchase managementprocurement

E-commerce Account Managment Lead - CBT (Cross Border Trade)
ACUITTY CONSULTANTS LLP Hiring For AcuittyTech 1.00 to 2.00 Years Gurugram 01 Apr, 2025

Key Responsibilities: As an e-commerce account manager, you will work with one of the worlds largest companies to guide their partners ( business-to-businesskey account managementaccountabilitycommunication skillsexport import documentationrelationship buildingms excele-commerce account managementproduct listing

Data Modeler Team Lead/Architect
Angel and Genie 7.00 to 10.00 Years Gurugram 01 Apr, 2025

Data Modeler Architect Position: Data Modeler Architect Experience: 8 years Location: Gurugram Department: IT/Data Architecture Reports to: Data Architecture Lead / Data Manager Position Overvie...
big dataawsdata visualizationgcpazure

Quantity Surveyor
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Guwahati 01 Apr, 2025

Also known as cost consultants, quantity surveyors ensure building projects remain within budget. They provide cost and material estimates, draw up projected budgets, and work alongside a team, ...
quality managementquantity analysisquantity surveyingquality assurancequantity estimationquality control

Marketing Executive
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Bhagalpur, Hyderabad, Pune, Patna, Guwahati 01 Apr, 2025

Marketing executives coordinate and oversee campaigns geared at promoting products, services, and causes. Marketing executives are adept at a variety of platforms, including print and social med...
marketing researchmarketing communicationmarketing managementbrand managementmarketing

Purchasing Assistant
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 12.00 to 22.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Panaji 01 Apr, 2025

Job brief We are seeking a detail-oriented Purchasing Assistant to join our team. Your main responsibility will be to order supplies and equipment in accordance with our companys needs. This...
purchasepurchase requisitionengineeringengineering designengineering managementproject engineeringpurchase management

Automotive Engineer
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Noida, Jaipur, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Guwahati 01 Apr, 2025

Job brief We are looking for a skilledAuto Mechanicto maintain and repair vehicles. You will be responsible for troubleshooting issues and fixing them aiming to maximum relia...
constructionautomobile engineeringautomobileconstruction managementengineering management

Hiring For Online Marketing Executive (Work From Home Or Office Both) DELHI-NCR
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 01 Apr, 2025

Dear Candidate Greetings fromDesnor Destination Pvt Ltd ! Job Summary Idealises Internet Marketing Agency is looking for Marketing Executive to join our dynamic team and embark on a rewarding...
marketing planningdigitaldisplay advertisingmarketingfreelancingwork from homemarketing communicationpart time

Head Admin
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 5.00 to 10.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 01 Apr, 2025

Main Responsibilities:

Strategic Planning:

Identify opportunities for operational efficiency and cost savings within the administrative functions.

Prepare an...
administration managementoffice operationstravel deskfacility managementfacility operationscorporate administration

Full Stack Developer
LTIMindtree Limited 6.00 to 10.00 Years Noida,Hyderabad 01 Apr, 2025

Job Description Develop maintain enhance and test client systems of moderate to high complexity Execute full software development life cycle SDLC build highquality innovative and performing sof...
sdlcjavaaws

Python API -Developer
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 2.00 to 6.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

Represent API Support with project teams to ensure that API knowledge is provided, thus ensuring effective support for new products and enhancements

Grow an up-to-date knowledg...
data visualizationgitlanguagecssapplication developmentpythonjavascriptchange managementdata structureshyperanalyticshtmlmarkup

Lead Maintenance Supervisor
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 3.00 to 7.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 01 Apr, 2025

Key Responsibilities:

Team Supervision:

Lead, train, and mentor a team of maintenance technicians and staff.

Assign tasks and p...
programmingwellnessinspectionmanagementvalvesschedulingsafety trainingexecutive engineering

Account Management Director
SPENTO PAPERS (INDIA) LLP 12.00 to 22.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Tadepalligudem, Mumbai City 01 Apr, 2025

We are seeking an experienced Account Management Director to lead and optimize our Account Management team. This leadership role will focus on driving customer success and revenue growth, ensuri...
medicaresalesservicemedicaidcustomerbusinessdevelopmentoversightprocessimprovement

Workforce Management Consultant
DIGITALCUBE CONSULTANCY SERVICES PRIVATE LIMITED 8.00 to 10.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

Designation: Workforce Management Consultant Experience Required: 8 years Work Mode: WFH Key Responsibilities: kronos timekeepingkronos wfcwfmsap hrpro

Management Representative
ALTSEO PRIVATE LIMITED 15.00 to 25.00 Years Gurugram,Delhi, Bangalore, Chennai, Bhagalpur, Hyderabad, Kolkata, Mumbai City, Anantpur, Ahmedabad 01 Apr, 2025

Managers ensure that their assigned department, store, or district is well staffed and provisioned, adheres to quality and service standards, increases revenue and market share, and helps the bus...
qualitycollaborationdecision-makingmanagementcommunicationleadershipproblemsolvingdelegationproject

Business Development Manager
ADITYA BIRLA SUN LIFE INSURANCE COMPANY LIMITED 1.00 to 2.00 Years Gurugram,Delhi, Faridabad, Ghaziabad 01 Apr, 2025

Designation:Agency Manager Education:Any Graduates Experience:Fresher with Good network / Min. 1 Yearin anyDomain Sal...
salesinsuranceagency channelbfsi sales

Brand Manager
MNR Solutions Pvt Ltd 10.00 to 16.00 Years Gurugram 01 Apr, 2025

Brand Manager Key Responsibilities: Develop and execute comprehensive brand strategies and marketing plans, collaborating with the founders to drive brand growth and strengthen market presence...
brand managementbrand marketingbrand planningbrand campaigns

Urgent Vacancy for Primary Teacher
MATTRIXX INDIA 0.00 to 4.00 Years Gurugram,Delhi, Noida, Gandhinagar, Jaipur, Kolkata, Ranchi, Mumbai City, Bhopal, Patna 01 Apr, 2025

Job Title: Primary Teacher (Class 1-5)CBSE and ICSE boards Job Type: Full-time ( Work from Home )
management skillslesson planningcontent developmentquery resolution

office itor
ASSETCARE SERVICES PRIVATE LIMITED 1.00 to 5.00 Years Gurugram,Delhi, Faridabad, Bangalore, Chennai, Hyderabad, Kolkata, Chittoor, Chandigarh, Ahmedabad 01 Apr, 2025

Janitors work to keep schools, offices, libraries, and hospitals, clean and maintained. They are often asked to work outside normal business hours sometimes early in the morning or late at night ...
adaptabilitycommunication skillsindependencetime managementproblem-solvingphysical stamina

Applications Developer
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 13.00 to 23.00 Years Gurugram,Delhi, Noida, Jaipur, Bangalore, Jaisalmer, Chennai, Hyderabad, Pune, Guwahati 01 Apr, 2025

Job brief We are seeking a qualified and talented Application Developer to join our team. In this role, you will be responsible for designing and coding functional programs and applications. ...
architecture governancevalue engineeringconstruction managementdeveloper/d2kengineeringapplication architecture

Plant Engineer
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 12.00 to 22.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Nellore, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

We are looking for a Plant Manager to drive continuous improvement and optimization of all processes.
Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla...
project engineeringprocess equipmentengineering processengineeringplant engineering

Business Associate
ALTSEO PRIVATE LIMITED 15.00 to 25.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

We are looking for an energetic business development associate to help drive our sales and grow the business. You will attract new clients and build solid relationships with them while maintainin...
visualizationsalesservicemanagementmarketingterminologycommunicationcustomerprojectmedicalstatementsskills

Part Time-Work From Home-Freelancing Computer-Data Entry Operator (Delhi-NCR)
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 01 Apr, 2025

Dear Candidate Greetings fromDesnor Destination Pvt Ltd ! Job Summary on our company databases and computer systems. Data Entry Operator responsibilities include collecting a...
freelancingcomputer operatingdata entrypart timedata managementhomehome basedfresherfromwork

Warehouse Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 9.00 Years Gurugram,Delhi, Bangalore, Chennai, Hyderabad 01 Apr, 2025

Responsibilities and Duties Preparing documents related to dispatch such as invoices, shipping-labels, picklists etc Picking products from the warehouse for each batch Getting the products packed...
transportwarehouse managementlogistics managementwarehouse clerkpacking materialslogistics freight station warehousingwarehouse managersupply chainswarehouse logistics

NTT DATA Virtual Drive Hedge Fund Gurgaon
NTT DATA INFORMATION PROCESSING SERVICES PRIVATE LIMITED 1.00 to 3.00 Years Gurugram 01 Apr, 2025

NTT DATA is Hiring experienced candidates for Hedge Fund Accounting domain. Location:Gurgaon Sector 48 (Candor Techspace) Work from Office Only Shift ...
reconciliationhedge fundsnav calculationinvestment banking

Customer Care Executive
Elevate X solutions 0.00 to 3.00 Years Gurugram 01 Apr, 2025

Job Title Customer Care Executive Location Gurgaon Salary: 15,000 - 25,000 per month Job Description We are seeking enthusiastic Customer Care Executives for our BPO operations in Gurgaon. Res...
time managementcareer counsellingproblem solvingcustomer careexcel

Area Sales Manager
SARANSH BIO ORGANIC PRIVATE LIMITED 1.00 to 5.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 01 Apr, 2025

Visit Doctors and other healthcare professional to promote, sell & demonstrate the Lifestyle healthcare Products

Identifying prospective business opportunities for the company....
business developmentpharmaceutical salesarea sales managementayurvedic medicine

PREV
NEXT

fusion project portfolio management Job Openings

Pipeline Engineer Job Description Template We are looking for a highly experienced pipeline engineer to design and develop a variety of pipeline... budgetingblueprintcommunicationrepairconstruction technologytechnical standards

Job brief We are looking for a skilledAuto Mechanicto maintain and repair vehicles. You will be responsible for troubleshooting issues and fixing them aiming to maximum relia... constructionautomobile engineeringautomobileconstruction managementengineering management

Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla... project engineeringprocess equipmentengineering processengineeringplant engineering

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Pipeline Engineer Job Description Template We are looking for a highly experienced pipeline engineer to design and develop a variety of pipeline...
budgetingblueprintcommunicationrepairconstruction technologytechnical standards

Job brief We are looking for a skilledAuto Mechanicto maintain and repair vehicles. You will be responsible for troubleshooting issues and fixing them aiming to maximum relia...
constructionautomobile engineeringautomobileconstruction managementengineering management

Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla...
project engineeringprocess equipmentengineering processengineeringplant engineering