government agencies jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

government agencies Job Openings

Showing 201 - 250 of 6090 Jobs

Head - Finance & Accounts

JOBS HELP CONSULTANCY 1.00 to 10.00 Years Hyderabad, IndoreIndore, Lucknow, Kolkata, Pune, Delhi, Haridwar 28 Jul, 2026

Head - Finance & Accounts

General Manager - Operations

DIGITALCUBE CONSULTANCY SERVICES PRIVATE LIMITED 1.00 to 10.00 Years Surat 28 Jul, 2026

Job Description

Designation

Experience Required

Location

Key Respons...
financial planningmis reportingngo operations

Resident Construction Manager
AI MZ-Tech Consultant 1.00 to 10.00 Years Gurugram, DelhiDelhi, Bangalore, Chennai, Kurnool, Hyderabad, Kolkata, Pune, Kakinada, Mumbai City 28 Jul, 2026

Resident Construction Manager Resident Construction Manager (RCM) Education B.E / B.Tech or Diploma ( Electrical / Civil ) Experience 10 - 15 years Location Project sites at ...
residentialresident activitiesresidential cleaningresidency programsresidential salesresidence liferesidential careresinresidential additions

Senior Manager Asset Management (Remote) (Erode)
Staten Solar 1.00 to 10.00 Years Erode 28 Jul, 2026

Job Title: Senior Manager Asset Management Power Purchase Agreement (PPA) & Commercial Asset Management Location: Remote (Supporting California, USA) Position Summary The Senior Manager ...
BudgetingPower Purchase Agreement PPA ManagementCommercialFinancial Asset ManagementForecastingCash Flow ManagementUtility BillingRevenue ReconciliationLease AdministrationInvestor ReportingRenewable Energy Certificate WREGIS ManagementContract Adm

Patient Welfare Officer
Needs Ayurveda Private Limited 1.00 to 10.00 Years Erode, TuticorinTuticorin, Bangalore, Kozhikode, Hyderabad, Kolkata, Pune, Mangalore, Bilaspur, Ratl 28 Jul, 2026

Patient Welfare Officer acts as a vital bridge between patients and hospital management. They are responsible for ensuring holistic patient well-being by gathering feedback, resolving complaints,...
patiencemedical terminologyemotional intelligencemedical recordspatient relationsstress managementpatient advocacypatient rightshealthresilienceelectronic

Requirement for Chemistry,Organic Chemeistry,Biochemeistry Graduates
ACHIEVERS SPOT Hiring For Medical Coding 1.00 to 10.00 Years Erode, MaduraiMadurai, Coimbatore, Chennai, Ramanathapuram, Pudukottai, Kanyakumari, Hosur, Dharmapu 28 Jul, 2026

DESCRIPTION
As a Zoologist in Chennai, you will study animals and their behavior, habitats, and ecosystems. You will be involved in research, conservation efforts, an...
nursingbiomedicalbiotechnologymedical codingpharmabioinformaticsbiochemistrybiology

Medical Coding
ACHIEVERS SPOT Hiring For MEDICAL CODING 1.00 to 10.00 Years Erode, MaduraiMadurai, Tiruchirappalli, Chennai, Thirunelveli, Salem, Nagercoil, Tuticorin, Cuddalor 28 Jul, 2026

A physiotherapybiotechnologymedical codingmicrobiologybioinformaticsnursingpharmacybiomedicalmedical lab technology

Resident Construction Manager
AI MZ-Tech Consultant 1.00 to 10.00 Years Delhi, BangaloreBangalore, Chennai, Kurnool, Hyderabad, Kolkata, Gurugram, Pune, Kakinada, Mumbai Ci 28 Jul, 2026

Resident Construction Manager Resident Construction Manager (RCM) Education B.E / B.Tech or Diploma ( Electrical / Civil ) Experience 10 - 15 years Location Project sites at ...
residentialresident activitiesresidential cleaningresidency programsresidential salesresidence liferesidential careresinresidential additions

Agricultural Specialist
AYURSMITH WELLNESS (OPC) PRIVATE LIMITED 1.00 to 10.00 Years Delhi, NoidaNoida, Oman, Qatar, Saudi Arabia, Bangalore, Philippines, Chennai, Kurnool, United Arab 28 Jul, 2026

A park ranger safetyemergencypubliccollectionreservationsservicepatrolcustomerinterpretivefeesituationsvisitorprogramsrangersservices

Payroll Administrator
FW FUTURESWINGS PRODUCTS & SERVICES (OPC) PRIVATE LIMITED 1.00 to 10.00 Years Chandigarh, PurniaPurnia, Bangalore, Chennai, Hyderabad, Chittoor, Gurugram, Kolkata, Delhi, Patna 28 Jul, 2026

A Payroll Administrator communicationconfidentialitytechnical proficiency

SAS Trainer Freelance
WebTech Software Solutions 1.00 to 10.00 Years Chennai, BangaloreBangalore, Hyderabad, Mumbai City 28 Jul, 2026

Effectively Conduct Training for Fresh Graduate Students , Corporate Professional , Corporate , Government Agencies on SAS All SAS Trainer are required to provide training based on SAS official...
sas sqlsassas web report studiosas macrossas di studiosas bi

Site Security Operations In-charge
Adani Group 1.00 to 10.00 Years Ahmedabad 28 Jul, 2026

About Business: Adani Group: Adani Group is a diversified organisation in India comprising 10 publicly traded companies. It has created a world-class logistics and utility infrastructure portfoli...
Security Operations ManagementThreat IntelligenceRisk MitigationCrisis ManagementTechnology IntegrationReportingTrainingDevelopmentIncident Response

Maintenance Head
JOBS HELP CONSULTANCY 1.00 to 10.00 Years Ahmedabad, NashikNashik, Bhubaneswar, Dehradun, Lucknow, Kolkata, Jamshedpur, Pune, Delhi, Bhopal 28 Jul, 2026

Maintenance Head - 1-Over all plant maintenance mechanical, electrical and civil(mepc). 2-Preventive maintenance of machine equipment. 3-Minimum break down time and maximum m...
machine maintenancemechanical maintenancemaintenanceutility maintenanceplant maintenance

Director - Demand Partnerships
Jobrapido 1.00 to 10.00 Years Vijayawada 22 Jul, 2026

Director, Demand Partnerships strongmetrics | Gurgaon (HQ) | Full-time About strongmetrics strongmetrics is a fast-scaling adtech company operating across performance advertising, programmat...
agency salescommunication skillsrelationship managementmarket analysisprogrammaticdigital advertisingdemand partnershipsDSP partnershipsprogrammatic business developmentcommercial negotiation

Project Head - Real Estate/Construction
HR JOBS CONSULTANCY 1.00 to 10.00 Years Vadodara, NashikNashik, Bangalore, Indore, Lucknow, Gurugram, Kolkata, Jamshedpur, Pune, Barmer 22 Jul, 2026

Project Head - Real Estate/Construction Role: Project Head (Real Estate / Construction) Reporting To : Managing Director / CEO / COO Job Purpose: project managementproject executionproject planning

Food Science & Processing
AYURSMITH WELLNESS (OPC) PRIVATE LIMITED 1.00 to 10.00 Years Tirupati, ChennaiChennai, Hyderabad, Kurnool, Qatar, Bangalore, Kuwait, Noida, Philippines, United A 22 Jul, 2026

A Food Science & Processing professional culinarytrialssupporttechnicalspecificationsdevelopmentmanagementsafetyfoodprojectpilotplantproduct

Asst Manager Collection Auto Loan Surat, rajkot, Motihari,
Talent Leads HR Solutions Pvt Ltd 1.00 to 10.00 Years Surat, RajkotRajkot, Anand 22 Jul, 2026

Allocation of portfolio to vendor basis the past performance trend and FOS availability, creating adequate manpower capacity for the portfolio.

Review cases with FOS / TL and w...
collection managementcollections

Chief Security Officer
JOBS HELP CONSULTANCY 1.00 to 10.00 Years Ranchi, PatnaPatna, Bhubaneswar, Indore, Lucknow, Hyderabad, Navi Mumbai, Delhi, Bhopal 22 Jul, 2026

Chief Security Officer Position Summary We are looking for a highly disciplined and dynamic Chief Security Officer (CSO) to lead the end-to-end security operations. The incumbe...
security managementarmy retiredairforceindustrial securityvigilancedefencemilitary

Senior BDM IT Services & Staffing Partnerships (Raipur)
2400 1.00 to 10.00 Years Raipur 22 Jul, 2026

Job Type: Full-time Senior Business Development Manager IT Services & staffing Industry Experience OnlyLocation: Remote (India)Experience: 7 YearsEmployment Type: Full-timeCompensation: Total An...
IT Services SalesB2B SalesNegotiationPresentationCommunicationEnterprise Business DevelopmentStaffing SalesConsulting SalesEnterprise Partnerships

Marketing Head
GAURAV BUILDERS 1.00 to 10.00 Years Raipur 22 Jul, 2026

Job description: Marketing Head (Real Estate Residential & Commercial Projects) Position: Marketing Head Industry: Real Estate (Residential & Commercial Projects) Location: TATIBANDH, RAIPUR C....
Real Estate MarketingDigital MarketingLead GenerationMarket ResearchCampaign ManagementBrand BuildingSEOSEM

General Manager - Plant Operations & Administration
JOBS HELP CONSULTANCY 1.00 to 10.00 Years Raipur, NoidaNoida, Indore, Hyderabad, Kolkata, Pune, Chakan, Bawal, Ankleshwar, Solan 22 Jul, 2026

General Manager - Plant Operations & Administration Job description Responsible for general administration of the Plant Liaising with external government bodi...
plant operationsprocess managementproduction managementliaisoningppccommercial operations

||Urgent Hiring For ||Tender Executive ||Location Tilak Nagar, New Delhi ||
Orbitouch Outsourcing Private Limited 1.00 to 10.00 Years Delhi 22 Jul, 2026

||Urgent Hiring For ||Tender Executive ||Location: Tilak Nagar, New Delhi || Company:Orbitouch Outsourcing Private Limited Profile :- Tender Executive (only Female) Location:Ti...
bid managementtenderingbid preparationtender managemente-procurementprocurementcppp

Chief Security Officer (CSO)
JOBS HELP CONSULTANCY 1.00 to 10.00 Years Noida, DelhiDelhi, Lucknow, Bangalore, Indore, Hyderabad, Jamshedpur, Pune, Bhopal, Patna 22 Jul, 2026

Chief Security Officer (CSO) Key Responsibilities Develop and execute enterprise-wide security strategy covering physical security Oversee security of project sites, plants, e...
security auditssecurity servicessecurity compliancesecurity operations

Plant Safety Manager
TALENTCO HR SERVICES LLP 1.00 to 10.00 Years Navi Mumbai, Mumbai City 22 Jul, 2026

Job Title: Plant Safety Manager
Job Description
The Plant Safety...
risksafetyemergencyhseinvestigationhealthmanufacturingauditassessmentehsindustrialaccidentplantoccupationalmanager

Project Head - Real Estate/Construction
HR JOBS CONSULTANCY 1.00 to 10.00 Years Lucknow, NashikNashik, Bangalore, Indore, Gurugram, Kolkata, Jamshedpur, Pune, Vadodara, Barmer 22 Jul, 2026

Project Head - Real Estate/Construction Role: Project Head (Real Estate / Construction) Reporting To : Managing Director / CEO / COO Job Purpose: project managementproject executionproject planning

General Manager - Plant Operations & Administration
JOBS HELP CONSULTANCY 1.00 to 10.00 Years Indore, NoidaNoida, Raipur, Hyderabad, Kolkata, Pune, Chakan, Bawal, Ankleshwar, Solan 22 Jul, 2026

General Manager - Plant Operations & Administration Job description Responsible for general administration of the Plant Liaising with external government bodi...
plant operationsprocess managementproduction managementliaisoningppccommercial operations

Project Head - Real Estate/Construction
HR JOBS CONSULTANCY 1.00 to 10.00 Years Indore, NashikNashik, Bangalore, Lucknow, Gurugram, Kolkata, Jamshedpur, Pune, Vadodara, Barmer 22 Jul, 2026

Project Head - Real Estate/Construction Role: Project Head (Real Estate / Construction) Reporting To : Managing Director / CEO / COO Job Purpose: project managementproject executionproject planning

Chief Security Officer (CSO)
JOBS HELP CONSULTANCY 1.00 to 10.00 Years Indore, BhopalBhopal, Bangalore, Noida, Hyderabad, Lucknow, Jamshedpur, Pune, Delhi, Patna 22 Jul, 2026

Chief Security Officer (CSO) Key Responsibilities Develop and execute enterprise-wide security strategy covering physical security Oversee security of project sites, plants, e...
security auditssecurity servicessecurity compliancesecurity operations

SAS - Online Trainer
WebTech Software Solutions 1.00 to 10.00 Years Hyderabad, BangaloreBangalore, Chennai, Mumbai City 22 Jul, 2026

Effectively Conduct Training for Fresh Graduate Students , Corporate Professional , Corporate , Government Agencies on SAS All SAS Trainer are required to provide training based on SAS official...
sas sqlsassas web report studiosas macrossas di studiosas bi

Agricultural Specialist
AYURSMITH WELLNESS (OPC) PRIVATE LIMITED 1.00 to 10.00 Years Gurugram, DelhiDelhi, Noida, Oman, Qatar, Saudi Arabia, Bangalore, Philippines, Chennai, Kurnool, Un 22 Jul, 2026

A park ranger safetyemergencypubliccollectionreservationsservicepatrolcustomerinterpretivefeesituationsvisitorprogramsrangersservices

Project Head - Real Estate/Construction
HR JOBS CONSULTANCY 1.00 to 10.00 Years Gurugram, NashikNashik, Bangalore, Indore, Lucknow, Kolkata, Jamshedpur, Pune, Vadodara, Barmer 22 Jul, 2026

Project Head - Real Estate/Construction Role: Project Head (Real Estate / Construction) Reporting To : Managing Director / CEO / COO Job Purpose: project managementproject executionproject planning

Admin Manager
Talent Leads HR Solutions Pvt Ltd 1.00 to 10.00 Years Lucknow 22 Jul, 2026

Scope This role covers: Oversee end-to-end administration and facility management across all company locations Manage company-owned properties, office infrastructure, and asset maintenance Ha...
facility managementadministration

Chief Security Officer (CSO)
JOBS HELP CONSULTANCY 1.00 to 10.00 Years Lucknow, NoidaNoida, Delhi, Bangalore, Indore, Hyderabad, Jamshedpur, Pune, Bhopal, Patna 22 Jul, 2026

Chief Security Officer (CSO) Key Responsibilities Develop and execute enterprise-wide security strategy covering physical security Oversee security of project sites, plants, e...
security auditssecurity servicessecurity compliancesecurity operations

Patient Welfare Officer
Needs Ayurveda Private Limited 1.00 to 10.00 Years Erode, TuticorinTuticorin, Bangalore, Kozhikode, Hyderabad, Kolkata, Pune, Mangalore, Bilaspur, Ratl 22 Jul, 2026

Patient Welfare Officer acts as a vital bridge between patients and hospital management. They are responsible for ensuring holistic patient well-being by gathering feedback, resolving complaints,...
patiencemedical terminologyemotional intelligencemedical recordspatient relationsstress managementpatient advocacypatient rightshealthresilienceelectronic

Wanted B pharm Fresher For Medical Coding
ISKILLS SOLUTIONS 1.00 to 10.00 Years Chennai, VelloreVellore, Viluppuram, Tiruchengode, Thoothukudi, Salem, Nagercoil, Dindigul, Neyveli, 22 Jul, 2026

Role- Medical Coder: We are looking to hire an fresher Coder (B Pharm, Microbiology, Biology etc.)With strong domain expertise in CPT and ICD (diagnosis) coding, the incumbent should be able to v...
radiologycardiologyanesthesianursingdialysisbiologyzoologybiochemistry

Dcs Engineer
UNInternational 1.00 to 10.00 Years Ahmedabad, BhubaneswarBhubaneswar, Chennai, Hyderabad, Kolkata, Vishakhapatnam 22 Jul, 2026

Responsibilities:

Review of all documentation assigned by the commissioning manager such as; drawings, lists, calculations, procedures, instructions, protection/control...
commissioningdcscombustionturbine

Purchase Manager
Dhruv Corporate (HR) Solutions Pvt Ltd 1.00 to 10.00 Years Ahmedabad 22 Jul, 2026

Job Title: Purchase Manager Location: Ahmedabad Salary: 6 7 LPA Job OverviewWe are looking for an experienced and detail-orientedPurchase Managerto manage end-to-end procure...
managementvendor managementprocurementgrncoststores

Software Development Engineering, Specialist
Finserv 1.00 to 10.00 Years All India, Noida 20 Jul, 2026

You will play a critical role at Fiserv as a Software Development Engineering - Sr Professional I by designing, developing, and maintaining high-quality software applications. Your responsibilitie...
HTML5CSS3RESTWPFSQL QueriesStored ProceduresSQLOracleSOABusiness ServicesSoftware EngineeringBanking DomainASPNET CAngularNETWin formsLarge Distributed Systems

National Sales Manager Medical Devices & IC , Government Business
Talent Leads HR Solutions Pvt Ltd 1.00 to 10.00 Years Lucknow, Delhi 20 Jul, 2026

Purpose The purpose of the National Sales Manager (NSM) Government Business is to lead and drive the organizations government sales strategy, ensuring sustainable revenue growth...
salesmedical devices

Looking for Institutional Sales Manager - Diagnostics for Thane and Panvel
JobFlip 1.00 to 10.00 Years Navi Mumbai, ThaneThane, Panvel 20 Jul, 2026

We are urgntly looking for a Institutional Sales Manager - Diagnostics for Thane and Panvel location. Interested candidates can call me on hidden_m...
business developmentmarket analysisaccount managementdiagnosticsinstitutional salessales growthsales strtegy execution

National Sales Manager For Medical Device based at Delhi
Talent Leads HR Solutions Pvt Ltd 1.00 to 10.00 Years Delhi 20 Jul, 2026

Role Scope: The National Sales Manager (NSM) Government Infection Control (IC) is responsible for leading the company's government sales strategy, driving business growth through Central and ...
government salesmedical devices

Operations Manager Background Verification (BGV)
Checkaro Verifications Private Limited 1.00 to 10.00 Years Bangalore 20 Jul, 2026

Operations Manager Background Verification (BGV) About the Company Checkaro Verifications Private Limited is a background verification (BGV) services company committed to helping organizations ...
Background VerificationTeam ManagementClient Relationship ManagementComplianceProcess ImprovementAutomationMS ExcelReportingAnalytical Skills

Operations Manager - Ground Transport Services
Adani Enterprises Ltd 1.00 to 10.00 Years Ahmedabad 20 Jul, 2026

Manager - Operations Lead (Ground Transport Business) About Business: Adani Group : Adani Group is a diversified organisation in India comprising 10 publicly traded companies. It has created a wor...
operations managementrevenue generationbusiness developmentcompliance managementstakeholder managementteam leadershiprisk managementfinancial performance analysis

GTM Strategy & Operations Manager - EU / UK
vacancy target jobs 1.00 to 10.00 Years All India 20 Jul, 2026

As reputed companys GTM Strategy & Operations Manager based in the UK, you will help build and execute the strategy and operations for a best-in-class sales organisation. In this role, you will pa...
Sales OperationsSales StrategyQuota SettingAccount ManagementAccount PlanningData AnalysisProcess OptimizationData AnalyticsRegulated Payments

US Payment Merchant Taxation Operations Analyst Bangalore
WHITE HORSE MANPOWER CONSULTANCY (P) LTD 1.00 to 10.00 Years Bangalore 20 Jul, 2026

Job Description (JD)
reconciliationtax compliancefinancial operationsbanking operationslevy processingfinopspayment taxationirs noticesus payments

Senior Analyst
FNF India Private Limited 1.00 to 10.00 Years Bangalore 20 Jul, 2026

WALK-IN DRIVE | Senior Analyst | Operations | 2-6 Years | Tuesday 21st Were Hiring! Join a leading organization and build your career in Operations.

Position: document verificationtitle searchms officetitle searchesowner searchdata entry order processingcurrent owner search

VP of Sales (B2B SaaS | MarTech | Marketing Agencies)
Two Minute Reports — Marketing Analytics for Agencies 1.00 to 10.00 Years Bhopal 20 Jul, 2026

Company:Two Minute Reports Location: Chennai / Remote (India) Employment Type: Full-Time About Two Minute Reports Two Minute Reports is a fast-growing B2B SaaS platform that helps marketing agen...
sales strategypipeline developmentcustomer acquisitionsales operationsB2B SaaS salesrevenue growthsales leadershipCRM platformsmarketing agencies

Director Brand Partnerships & Revenue ( Influencer Marketing Agency)
Socio Impulse 1.00 to 10.00 Years Gurugram 20 Jul, 2026

We are hiring! | Director - Revenue & Brand Partnerships Location: Gurgaon (Onsite) Experience: 57 Years Apply To: hidden_email About Socio Impulse At Socio Impuls...
Influencer MarketingTalent ManagementRevenue ManagementStrategic AlliancesBusiness DevelopmentNegotiationForecastingBrand ManagementPL Management

Vice President - Sales & Marketing(Advertisement)
The Adbook India Private Limited 1.00 to 10.00 Years Ahmedabad 20 Jul, 2026

WERE HIRING | VICE PRESIDENT ADVERTISEMENT Lead. Innovate. Transform Indias DOOH Advertising Industry. The Adbook India Private Limited is on a mission to build one of Indias fastest-growing Dig...
SalesMarketingAdvertisingBusiness DevelopmentMedia SalesRelationship BuildingLeadershipTeam ManagementNegotiation

Mall Marketing Manager
Tapadia City Centre 1.00 to 10.00 Years Amravati 20 Jul, 2026

Company DescriptionTapadia City Centre is western Vidarbhas premier mall, offering a specially curated mix of over 75 brands across fashion, electronics, footwear, home needs, food, and entertainm...
Interpersonal skillsRetail marketingSalesSocial media marketingDigital advertisingMarketing strategy developmentVendoragency coordinationMarket trend analysis

PREV
NEXT

government agencies Job Openings

DESCRIPTION

Job Description

Job Description (JD)

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers