mobile phone servicing jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

mobile phone servicing Job Openings

Showing 3601 - 3650 of 19277 Jobs

Customer Care Associate

SPHINX SOLUTIONS PRIVATE LIMITED Fresher Pune 28 Sep, 2025

About the Role:

Customer Success Associates

hindi

problem solving

relationship management

E-Book Typing Data Entry Executive

Divine HR Services Fresher Mangalore, HyderabadHyderabad, Chennai, Bangalore, Indore, Machilipatnam, Uttarakhand, Kolkata, Chit 28 Sep, 2025

Employment Type:

typing

back office

data entry

Urgent hiring for the SAP Service Asset Manager

CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Mumbai City, PunePune, Bangalore, Noida, Chennai, Hyderabad, Gurugram, Kolkata, Delhi 28 Sep, 2025

sap service asset manager

ssam

Online Data Entry English & hIndi Typist work (Part-Time/Full-Time)

Divine HR Services Fresher Hyderabad, VaranasiVaranasi, Bangalore, Rajahmundry, Chennai, Machilipatnam, Kozhikode, Kerala, Guwa 28 Sep, 2025

Roles:

part timeenglish typingcomputer operating

Customer Care, Voice Process with Digital Banking Exp in Blr, Pun, Hyd and Mum

WHITE HORSE MANPOWER CONSULTANCY (P) LTD Fresher Hyderabad, BangaloreBangalore, Pune, Mumbai City 28 Sep, 2025

Customer Care Executives

Digital Banking experience

digital banking

bfsi

customer care executive voice process

bank call center

banking customer support

mobile banking helpdesk

customer relationship executive

contact center banking

online banking support

Urgent hiring for the SAP Service Asset Manager

CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Hyderabad, BangaloreBangalore, Noida, Chennai, Gurugram, Kolkata, Pune, Mumbai City, Delhi 28 Sep, 2025

sap service asset manager

ssam

Phone Banking Officer

KNOWPLICITY RECRUITMENT AND TRAINING CONSULTANCY PRIVATE LIMITED Fresher Hyderabad 28 Sep, 2025

Hiring for Phone Banking Officer!(Bank Payroll) - Hyd

Inbound Customer service and Upselling of Banking Products

Resolve iss...
bpo voicetelecallingdomestic bpoinbound customer servicevoice processinbound call centerbanking processinbound callsinbound voice process

Lift Operator
SKA Group Fresher Ghaziabad, Uttar Pradesh 28 Sep, 2025

As a Lift Operator at SKA Group in Ghaziabad, you will play a crucial role in ensuring the safe and efficient operation of elevators within our residential projects. Your primary responsibility ...
Lift OperatorOperate elevatorsMaintain cleanlinessReport technical issuesAssist residentsFollow safety protocols

Support Analyst Tier 1/ Tier 2 Hybrid
myKaarma Fresher Noida, Uttar Pradesh 28 Sep, 2025

Role Overview: As a Support Analyst Tier 1 & Tier 2 at myKaarma, you will play a crucial role in providing front-line support for U.S.-based customers, handling Tier 1 and Tier 2 technical issues....
Technical SupportSQLDebugging toolsZendeskSalesforcemicroservicesSpring BootJavaJiraCustomer Service ExcellenceSaaS platformsPostmanCRMticketing tools

Online Data Entry English & hIndi Typist work (Part-Time/Full-Time)
Divine HR Services Fresher Chennai, VaranasiVaranasi, Bangalore, Rajahmundry, Machilipatnam, Hyderabad, Kozhikode, Kerala, Guwa 28 Sep, 2025

Job Vacancy For:-10th pass, 12th pass, Graduate/Post Graduate and Fresher can also apply Roles: Data Entry, Self Employed, Typist, Freelancer, Fresher, Data Entry Operator part timeenglish typingcomputer operating

OA Team Support
FOXCONN HON HAI TECHNOLOGY INDIA MEGA DEVELOPMENT PRIVATE LIMITED Fresher Chennai 28 Sep, 2025

Provide technical support to end-users via phone, email, or in-person. DB Data maintenance & SQL related activity . Ticketing system Management . Troubleshoot technical issues related to hardwa...
handlingconfigurationticketing systemsmaintenancesqldataciscoticketconference

Urgent hiring for the SAP Service Asset Manager
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Bangalore, NoidaNoida, Chennai, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City, Delhi 28 Sep, 2025

Job Descripton- Expertise in SAP SSAM based on MDK application and integration with SAP applications Knowledge of BTP platform Neo or CF to configure the connections to SAP S4/ECC system Confi...
hanamobiledeploymentdebuggingabapdevelopmentsapeccintegrationappsap service asset managerssam

Customer Service Executive
HARJAI COMPUTERS PRIVATE LIMITED Fresher Ahmedabad, BangaloreBangalore, Jaipur, Pune 28 Sep, 2025

Jobtype : Work from Office JobTitle: Customer Support Officer Location: Jaipur , Bangalore , Pune , Ahmedabad customer satisfactioninboundoutboundvoice processblended process

Customer Care, Voice Process with Digital Banking Exp in Blr, Pun, Hyd and Mum
WHITE HORSE MANPOWER CONSULTANCY (P) LTD Fresher Pune, BangaloreBangalore, Hyderabad, Mumbai City 25 Sep, 2025

We are hiringCustomer Care ExecutiveswithDigital Banking experiencefor our voice process team. The role involves handling customer queries, pro...
digital bankingbfsicustomer care executive voice processbank call centerbanking customer supportmobile banking helpdeskcustomer relationship executivecontact center bankingonline banking support

Marketo
LTIMindtree Limited Fresher Pune 25 Sep, 2025

Role Marketo Developer Skill Marketo KnowledgeHTMLCSSVelocity ScriptingBasic SQLRest API Knowledge Minimum Skill Requirements This exciting and interesting position will have the below respons...
Marketo

Frontend Developer/Angular Developer
Thinkersteps Technologies Pvt Ltd Fresher Nagpur, Maharashtra 25 Sep, 2025

As a frontend developer at our company, your role will involve designing, developing, testing, and debugging responsive web and mobile applications. You will utilize your skills in JavaScript, HTM...
JavaScriptHTMLCSSScrum

Urgent Hiring for International
ARTECH INFOSYSTEMS PRIVATE LIMITED Fresher Mumbai City, Bangalore 25 Sep, 2025

Qualification Any graduate (mandatory) Mode of Work (WFH or WFO) - WFO Interview process Versant, CD and OPS Interview Versant Thresh...
customer supportinternational call centervoice process

HVAC , chiller Operator
HAPPY SQUARE OUTSOURCING SERVICES LIMITED Fresher Mumbai City 25 Sep, 2025

Position

HVAC Operator- ITI RAC, 1 year experience

Chiller Operator- ITI RAC, 1 year experience

hvac installationhvac maintenance

Online Data Entry English & hIndi Typist work (Part-Time/Full-Time)
Divine HR Services Fresher Hyderabad, VaranasiVaranasi, Bangalore, Rajahmundry, Chennai, Machilipatnam, Kozhikode, Kerala, Guwa 25 Sep, 2025

Job Vacancy For:-10th pass, 12th pass, Graduate/Post Graduate and Fresher can also apply Roles: Data Entry, Self Employed, Typist, Freelancer, Fresher, Data Entry Operator part timeenglish typingcomputer operating

Technical Support Advocate Hyderabad | Microsoft Windows & O365
Live Connections Fresher Hyderabad 25 Sep, 2025

Hiring: Technical Support Advocate Hyderabad (Night Shifts) Location: Hyderabad microsoft windowswindows supporttechnical voice processcustomer supporttechnical supportoffice 365 / o365 supporttechnical chat

Tender / GeM Executive IT Hardware & AMC- Delhi
PRIMATE CONSULTING SERVICES PRIVATE LIMITED Fresher Delhi 25 Sep, 2025

Greeting! Job Title: Tender / GeM Executive IT Hardware & AMC Location: East of Kailash Experience Required: Minimum 3 years in the IT indust...
governmenthp iqe-marketplacegem

SAP Work Manager Developer
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Chennai, BangaloreBangalore, Noida, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi 25 Sep, 2025

SAP WorkManager: Primary Skill: SAP Work Manager Delivery Role: Sr. Developer Experience Profile: 06-10 years Candidate should have good knowledge and working experience of SAP Agentry/Work M...
spmmobile developmentjavasap work managerworkdevelopermanager

Accounts Invoicing Executive
Munara Agro Technologies Pvt Ltd Fresher Vijayawada, Andhra Pradesh 24 Sep, 2025

The key responsibilities for this role include generating and issuing accurate customer invoices in compliance with purchase orders, delivery notes, or agreements. You will be responsible for ensu...
InvoicingERP systemRevenue recognitionAccounts receivableSales coordinationOperations coordinationReport generationAccounts InvoicingTax laws

Office Administrator
RAJPUT PROTECTION SERVICE PRIVATE LIMITED Fresher Vijayawada, RajahmundryRajahmundry, Nellore, Kurnool, Tirupati, Vishakhapatnam, Canada, Bangalore, C 24 Sep, 2025

We are looking for a reliableOffice Administrator.They will undertake administrative tasks, ensuring the rest of the staff has adequate support to work efficiently. Thewillincludebookkeeping an...
administrative assistanceadministration managementadministrationoffice administrationadministrative operations

we are hiring for manager role WFH
GLORIOUS HR SERVICES PRIVATE LIMITED Fresher Vishakhapatnam, HyderabadHyderabad, Bangalore, Chennai, Ghaziabad, Navi Mumbai, Thane, Pune, Mumbai 24 Sep, 2025

On- Paper Manager Exp. mandate AWS,microsoft Azure exp mandate Only Male candidate Graduation Mandate 5 days working, Sat/Sun fixed week off US Shift 7:30 AM to 4:30 AM Work from Home Internatio...
project managementitil certifiedhelpdesk managementitil frameworkit managementmicrosoft azure

Backend .NET Developer
AppleTech Fresher Vadodara, Gujarat 24 Sep, 2025

As a Web Application Developer at AppleTechSoft, you will be required to have a minimum of 5 years of hands-on experience in developing web applications on the Microsoft Windows Platform and cloud...
Software DesignArchitectureREST APIOODAOPSQL ServerSQL QueriesJOINSDatabase DesignLINQDebuggingAnalytical SkillsJAVASCRIPTDOJODockerMicrosoft TechnologiesVerbal CommunicationWritten CommunicationMicrosoft Windows PlatformCloud Technolog

Quality Assurance Automation Engineer (Mobile and Web)
Ventaja International Corp Fresher Vadodara, Gujarat 24 Sep, 2025

As a Senior QA Automation Engineer at Ventaja International Corp., you will play a crucial role in enhancing quality assurance practices across mobile and web platforms. Your primary responsibilit...
AppiumSeleniumTestNGJUnitPythonJavaJavaScriptJenkinsJMeterPostmanBrowserStackGitLab CI

Power Apps/Power Automate and Power BI Expert
GLOINNT Fresher Vadodara, Gujarat 24 Sep, 2025

As an experienced candidate with 5-6 years of experience, your role will involve developing a responsive application that can run seamlessly on various devices such as tablets and mobile phones. Y...
Power BISharePointPower Apps

Information Security Analyst - Vulnerability Management
Secure Meters Limited Fresher Udaipur, Rajasthan 24 Sep, 2025

You will be working as a part of the IS department, requiring 2 to 5 years of experience, on a full-time basis with the flexibility to work from anywhere. Your primary responsibilities will incl...
VAPTEthical HackingSecurity TestingWeb TechnologiesOperating SystemsOWASPNetwork ProtocolsCertified Ethical Hacker CEH

Key Account Manager (Banca Sales)
Apex Services Hiring For One of the leading broking firm Fresher Surat, VadodaraVadodara, Rajkot, Nashik, Ahmedabad, Gandhidham, Vapi, Amravati, Mumbai City 24 Sep, 2025

Dear Candidate, Greetings From APEX SERVICES Designation- Assistant manager/Deputy manager banca salesshare marketdmatdematbrokingstock marketrelationship manager

Node.js Developer
R K Infotech Fresher Rajkot, Gujarat 24 Sep, 2025

As a Node JS Developer at our dynamic and fast-paced team dedicated to driving digital transformations, your role will involve: - Strong proficiency with JavaScript - Knowledge of Node.js and var...
JavaScriptHTMLCSSAJAXAngularJSPolymerClosureGit

Online Work From Home, Data Entry Typing , Computer Operator Typist Part Time
Ruppan India Nidhi Limited Fresher Rajkot, VadodaraVadodara, Nashik, Dehradun, Mohali, Bathinda, Udaipur, Amritsar, Panchkula, Mysore 24 Sep, 2025

We are offering a Job. Part Time Jobs, Data Entry Work, Online Computer Work, Work From Home, Back Office Executive, Typist Get paid daily for typing work done from mobile or PC Should have own...
part timeonline work from homeonline part timework from homeonline data entrydata entry typingdata entryhome based data entry

presales consultant
BSH TECHNOLOGIES PRIVATE LIMITED Fresher Bhubaneswar 24 Sep, 2025

Work closely with the Business Development & Sales teams to support lead qualification and opportunity conversion.

Conduct r...
crmpresentationsclientsmbsoftwaresalestoolsexcelpowerpointdemosmarketproposalsstrongmandatory.knowledgesystems.serviceslikeestimationsusing

Administrative Executive
SHRI BALAJI ENTERPRISES Fresher Bhubaneswar, BaddiBaddi, Indore, Kolkata, Jamshedpur, Pune, Mumbai City, Vadodara, Ahmedabad, Guwaha 24 Sep, 2025

About the Role The Administrative Executive supports day-to-day office operations, facilitating efficient coordination among multiple departments. This role requires excellent organisational ...
communicationofficemanagementadaptabilitysupporttimeorganisationalskill

Adobe AEP Developer - PAN India
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Bhubaneswar, BangaloreBangalore, Chennai, Noida, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City, De 24 Sep, 2025

We are currently hiring for an Adobe AEP Developer role. Please find the job details below Position - Adobe AEP Developer Location - PAN India Experie...
adobe analyticsplatformdeveloperadobeaep

Product Manager for Dust Collection System
Spark & Ray Technocrats Private Limited Fresher Raipur 24 Sep, 2025

As a highly motivated and technically proficient Mechanical or Instrumentation Engineer, you are being sought for the role of Product Manager focusing on Dust Collection Systems with specializatio...
Mechanical EngineeringInstrumentation EngineeringProduct ManagementDust Collection SystemsSolenoid ValvesCylindersTechnical SalesLead QualificationBag FiltersPulse Jet ValvesPurging ValvesPneumatic ProductsFRLsTubesFittings

Sales Head - Real Estate
Wallfort Group Fresher Raipur 24 Sep, 2025

As a Sales Head, you are a highly sociable individual who thrives on interacting with people and exudes optimism and an outgoing personality. In this role, you will serve as a dynamic leader withi...
LeadershipTrainingCoachingSales reportingBudget monitoringSales strategy development

Online Work From Home, Data Entry Typing , Computer Operator Typist Part Time
Ruppan India Nidhi Limited Fresher Pondicherry, SiliguriSiliguri, Tirupati, Pathankot, Kurukshetra, Patiala, Vellore, Asansol, Durgapur 24 Sep, 2025

We are offering a Job. Part Time Jobs, Data Entry Work, Online Computer Work, Work From Home, Back Office Executive, Typist Need some passionate youngester for a Digital MNC Project Work from y...
part timeonline part timedata entry typingwork from homedata entryonline work from homehome based data entryonline data entrydata entry part time

Customer Support Specialist
SATOPRADHAN PRIVATE LIMITED Fresher Amritsar 24 Sep, 2025

At Satopradhan, we are looking forCustomer Support Specialistsfor providing exceptional service and support to customers. Required Skills & Qualifications : call center operationscustomer supportcall center managementtelecallingcustomer service

Make Up cum Salon Manager (Female)
Hair Raiserz Luxe Fresher Punjab 24 Sep, 2025

You are seeking a Professional Make Up Artist cum Salon Manager (Female Only) to oversee the day-to-day operations of the salon. Your responsibilities will include supervising staff, managing sche...
Developing Marketing StrategiesFinancial TransactionsMicrosoft OfficeMake Up ArtistSalon ManagerSupervising StaffManaging SchedulesMarketing ServicesMaintaining Financial RecordsManaging InventoryAddressing Customer ConcernsIndustry Trends

Shopify Theme Developer
Akuna Technologies Fresher Mysore, Karnataka 24 Sep, 2025

The ideal candidate for this role should have a minimum of 2 years of experience in Shopify Development. You will be responsible for designing and developing custom Shopify Themes, working on both...
HTMLCSSJavaScriptShopify DevelopmentTheme DesignsLiquid TemplatesShopify App integrationsWeb design standards

Virtual Data Entry Clerk Office Operations
Divine HR Services Fresher Mysore, ChennaiChennai, Bangalore, Howrah, Tamil Nadu, Indore, Gangtok, Mumbai City, Port Blair, Coi 24 Sep, 2025

Dear Candidate, Well provide you Typing, SMS Sending, Ads Posting etc. online works which you can do by mobile orPosition Available: Fresher / Back Office / Computer Operator / Data Entry Opera...
data entryback officepart timeback office operationsenglish writingcomputer operating

Content Marketing Executive
FlyMedia Technology -IT Company Fresher Ludhiana, Punjab 24 Sep, 2025

As a Content Strategist, you will play a crucial role in leading content planning and execution across various platforms. Your primary responsibility will be to develop engaging content strategies...
Campaign ConceptsAnalyticsContent StrategistContent PlanningContent ExecutionCrafting Engaging Content StrategiesWriting Core MessagingCollaboration with Creative TeamsContent CalendarsStorytelling FrameworksCompelling CopywritingBriefScript Pr

Senior Graphics Designer
Flymedia Technology Fresher Ludhiana, Punjab 24 Sep, 2025

We are seeking an experienced Graphic Designer to join our team in Ludhiana. Your primary role will involve overseeing junior graphic designers and creating social media posts for various projects...
Graphic DesigningLogo DesignCommunication SkillsSocial Media Posts

Computer Operator / Data Entry Clerk
Divine HR Services Fresher Kollam, BangaloreBangalore, Howrah, Chennai, Hyderabad, Tiruchirappalli, Pondicherry, Thane, Pune, T 24 Sep, 2025

Position:Entry-Level / Back Office Assistant / Computer Operator / Data Entry Clerk. Job Type: Part-time / Home-Based / Flexible Experience: 0-1 Year Salary Range: 3.0 - 7 LPA Work Location: ...
typingback office operationsback officepart timedata entryenglish writing

Workforce Services Senior Analyst (Capacity Planning)
Albireo Recruiters Hiring For Accenture Fresher Kakinada, GunturGuntur, Hyderabad, Kurnool, Nellore, Chittoor, Guntakal, Anantpur, Bangalore, Chenna 24 Sep, 2025

Role Workforce Services Senior Analyst (Capacity Planning) Responsible for developing and managing accurate mid to short-term Capacity planning models. These forecasts inform staffing, budgeting...
cross functional coordinationcapacity managementms excelshrinkage controlworkforce managementcontact centeroccupancy planningsla managementaht

Workforce Services Senior Analyst (Capacity Planning)
Albireo Recruiters Hiring For Accenture Fresher Kakinada, GunturGuntur, Hyderabad, Kurnool, Nellore, Chittoor, Guntakal, Anantpur, Bangalore, Chenna 24 Sep, 2025

Role Workforce Services Senior Analyst (Capacity Planning) Responsible for developing and managing accurate mid to short-term Capacity planning models. These forecasts inform staffing, budgeting...
cross functional coordinationcapacity managementms excelshrinkage controlworkforce managementcontact centeroccupancy planningsla managementaht

Executive assistance
ASSETCARE SERVICES PRIVATE LIMITED Fresher Kakinada, HyderabadHyderabad, Ongole, Kadapa, Chittoor, Bangalore, Chennai, Gurugram, Kolkata, Delhi 24 Sep, 2025

An executive assistantprovides high-level administrative support to senior management by managing schedules, coordinating meetings, handling communications, preparing reports,...
communicationtechnicaldetailexperienceattentionproficiencyproblem-solvingorganizational

Customer Officer
VERTEX SECURITIES LIMITED Fresher Kochi, Kerala 24 Sep, 2025

As a Customer Care Team Lead, your primary role will be to oversee and guide the customer care team to provide exceptional service through various communication channels like phone, email, and cha...
Customer service managementLeadershipTeam managementCommunicationStock market operationsProblemsolvingInterpersonal abilitiesTrading platforms

Application Sales Jodhpur (IVD)
ACCUREX BIOMEDICAL PRIVATE LIMITED Fresher Jodhpur, Rajasthan 24 Sep, 2025

As an Application Sales Specialist at Accurex Biomedical in Jodhpur, you will be responsible for providing clinical application support and driving sales in the IVD domain. Your role will involve...
Application SupportSalesMarket IntelligenceDiagnostic InstrumentsCustomer Queries

PREV
NEXT

mobile phone servicing Job Openings

About the Role The Administrative Executive supports day-to-day office operations, facilitating efficient coordination among multiple departments. This role requires excellent organisational ... communicationofficemanagementadaptabilitysupporttimeorganisationalskill

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

About the Role The Administrative Executive supports day-to-day office operations, facilitating efficient coordination among multiple departments. This role requires excellent organisational ...
communicationofficemanagementadaptabilitysupporttimeorganisationalskill