outbound engagement jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

outbound engagement Job Openings

Showing 7001 - 7050 of 14698 Jobs

Chief Talent Officer

SPENTO PAPERS (INDIA) LLP 25.00 to 0.00 Years Mumbai City,Pune, Bangalore, Noida, Chennai, Hyderabad, Gurugram, Kolkata, Delhi, Itanagar 01 Apr, 2025

Hiring for Telecaller- Education sector

HARJAI COMPUTERS PRIVATE LIMITED 1.00 to 6.00 Years Mumbai City 01 Apr, 2025

Handle enquiries received through phone (toll free), web, email. Generate and qualify leads through outbound co...
educationcounsellingstudenttelecalleracademic

Hiring for Customer Service for Leading Insurance Company
CAREERPEN CONSULTANTS LLP 1.00 to 4.00 Years Mumbai City 01 Apr, 2025

Hiring open for customer service / Customer support in leading insurance firm Requirement - Graduation mandatory - More than 1 year of experience in outbound calls or inbound calls and customer...
salescustomer servicevoice processinbound processcustomer care

Business Development Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 8.00 to 12.00 Years Mumbai City,Pune, Bangalore, Noida, Chennai, Hyderabad, Gurugram, Delhi 01 Apr, 2025

Key Responsibilities:

Strategic Planning: Develop and execute strategic business development plans that align with company goals and target ma...
sales growthanalysismarket analysisadaptabilityadministration workmarketcommunicationstrategic planningstrategic thinkinginnovationnegotiationcontractsresearch

Inside Sales Executive - UK Process
E-SPIRITS IT SERVICES LLP 1.00 to 5.00 Years Lucknow,Other Uttar Pradesh 01 Apr, 2025

We are seeking a Inside Sales Executive with 1-3 years of experience to join our UK process sales team. The role involves managing the end-to-end sales process, from lead generation to deal clos...
Lead GenerationCustomer Relationship ManagementNegotiationSales ReportingCRM ManagementMarket ResearchCompetitor AnalysisCommunication SkillsSales ExperienceSales Process ManagementClosing DealsPersuasion SkillsCRM Software

Digital Marketing Specialist
Xpert Tutor 2.00 to 6.00 Years Lucknow,Other Uttar Pradesh 01 Apr, 2025

Company Description Xpert Tutor is dedicated to providing exceptional private tutoring services in Lucknow. Acknowledging the shortcomings of traditional teaching methods, we bridge the gap by of...
Digital MarketingSocial Media ManagementContent CreationCopywritingGraphic DesignData AnalysisReportingCommunication SkillsPPC CampaignsSEO OptimizationWeb Traffic Metrics AnalysisMarketing Automation ToolsCRM Software

Business Development Director
M/S B NANDI 7.00 to 12.00 Years Kochi,Qatar, Bhubaneswar, Mauritius, Bangalore, Noida, Sri Lanka, Chennai, United Arab Emirates, Nor 01 Apr, 2025

JobsBusiness Development Director Job duties and Responsibilities.

Develops and strengthens internal and external relationships that will lead to increased lead generation and market s...
business developmentbusiness researchbusiness-to-businessbusiness analysisbusiness management skillsbusiness excellencedirectoriesbusiness planningdirectorship

Quality Analyst
TRAVELMAGNET INFOTECH PRIVATE LIMITED 1.00 to 3.00 Years Lucknow 01 Apr, 2025

Job Summary:
We are seeking a detail-oriented and experienced Quality A...
call monitoringcallingcall managementcall quality

Opening Agency Development Manager Life Insurance Co. Ltd.
Niyukti Management Consultants Hiring For max life 4.00 to 9.00 Years Lucknow,Kanpur, Varanasi, Bareilly, Ghaziabad, Moradabad, Agra, Bhubaneswar, Kolkata, Patna 01 Apr, 2025

Job Opening: Agency Development Manager Life Insurance Co. Ltd. Location: Agra, Kolkata, Patna, Bhubane...
salesinsurancedirect salessales managerrelationship officersales development managerarea sales managersales officeragency manager

pharma insight sales
BHARTI HR CLEANER WALA ZEEVIKA JOBS Hiring For Bharti HR 2.00 to 6.00 Years Lucknow 01 Apr, 2025

Job Title: Inside Sales Representative Pharmaceutical Industry Location: Lucknow Job Type: Full-time Job Summary: We are seeking a highly motivated Inside Sales Representative to join our pharmac...
b2b salesproduct promotioncrmcold callingtelesaleslead generationcustomer engagementsales targethealthcare sales

Hiring for Field Sales Associate
AASAANJOBS PRIVATE LIMITED 1.00 to 5.00 Years Lucknow,Delhi, Jaipur, Gurugram, Ranchi 01 Apr, 2025

About the Company: Over the years, we have invested wisely in developing own proprietary tools and management methodologies which provide an edge to our client's relationship marketing progr...
sales marketingmarketing executive

Commodity Market
Bhatia International Ltd 2.00 to 6.00 Years Ludhiana,Other Punjab 01 Apr, 2025

Commodity Market Jobs In Ludhiana Position: Financial Executive Qualification: MBA/Graduation Location: Ludhiana Experience: 2 to 4 Years Job Profile Locate and acquire clients for companys ...
Excellent communication skills

Social Media Marketing Internship in Ludhiana
QuadB 0.00 to 4.00 Years Ludhiana,Other Punjab 01 Apr, 2025

Selected Interns Day-to-day Responsibilities Create and manage content by publishing images, videos, and written content Monitor and analyze user engagement and key metrics to adjust strategies ...
Content ManagementSocial Media ManagementAnalyticsSocial Media AdvertisingUser Engagement

Agency Manager - Health Insurance
Skill Sphere Placement Services Hiring For Niva Bupa Health Insurance 1.00 to 6.00 Years Ludhiana,Indore, Raipur, Jabalpur, Ujjain, Alwar, Chhindwara, Bhopal, Ambala, Raigarh 01 Apr, 2025

Profile: Unit Manager / Agency Manager / Business Development Manager Vertical : Agency CTC Offered :up to 4.5 LPA Incentives allowances agency channelinsurance salesgeneral insurancefield saleschannel partnershealth insuranceagency developmentbusiness development

Risk Consulting - FSRM -R-Python-SQL
EY 3.00 to 7.00 Years Kochi,Other Kerala 01 Apr, 2025

At EY, youll have the chance to build a career as unique as you are, with the global scale, support, inclusive culture and technology to become the best version of you. And were counting on your u...
SQLPythonPower BIMachine LearningArtificial IntelligenceETLTableauAlteryx

Senior Backend Developer NodeJS, NestJS, .Net
Yokomet 5.00 to 9.00 Years Kochi,Other Kerala 01 Apr, 2025

Company Description Yokomet is a dynamic IT startup specializing in crafting cutting-edge software solutions, innovative product development, and impactful digital marketing strategies. We create...
NetSoftware DevelopmentProgrammingDatabase managementCollaborationCommunicationNodeJSNestJSBackEnd Web DevelopmentObjectOriented ProgrammingComputer Science principlesCloud service integration

Business Development Director
M/S B NANDI 7.00 to 12.00 Years Kochi,Qatar, Bhubaneswar, Mauritius, Bangalore, Noida, Sri Lanka, Chennai, United Arab Emirates, Nor 01 Apr, 2025

JobsBusiness Development Director Job duties and Responsibilities.

Develops and strengthens internal and external relationships that will lead to increased lead generation and market s...
business developmentbusiness researchbusiness-to-businessbusiness analysisbusiness management skillsbusiness excellencedirectoriesbusiness planningdirectorship

E commerce Executive jaipur
GT Solusn 0.00 to 2.00 Years Jaipur 01 Apr, 2025

only female candidate need to apply for the post location jaipur experience 0.6 yrs - 2 years must have good english communication job duties

Manage product listings, descriptions,...
online lead generationonline salesonline business optimizationonline marketinglistingsonline business management

Opening for Lead Generation Specialist/Tele caller in BPO for Jaipur location
Reema Rai 0.00 to 4.00 Years Jaipur 01 Apr, 2025

At present we are having few urgent positions for Lead Generation Specialist/Tele callerwith Girnar Care one of our reputed client which is a Indias Premier Outsourcing and Offsh...
outbound salesbpooutboundtelecallingtelesales

Hiring for Field Sales Associate
AASAANJOBS PRIVATE LIMITED 1.00 to 5.00 Years Jaipur,Delhi, Lucknow, Gurugram, Ranchi 01 Apr, 2025

About the Company: Over the years, we have invested wisely in developing own proprietary tools and management methodologies which provide an edge to our client's relationship marketing progr...
sales marketingmarketing executive

Admission Counsellor
Indian School of Business Management and Administration Pvt Ltd 1.00 to 4.00 Years Jaipur 01 Apr, 2025

Company: Indian School of Business Management and Administration (ISBM) Website: isbm.org.in Position: Tele Counsellor /Education Counsellor/Career Adviser Qualification : Graduate or HSC Pass...
admission counsellingtelesalesoutbound saleseducational sales

HR Intern
Boltly Electric 0.00 to 4.00 Years Indore,Other Madhya Pradesh 01 Apr, 2025

About Boltly Electric: At Boltly Electric, were not just about charging up our electric vehicles, but also charging up the future of urban mobility. Were building a tech-enabled EV ecosystem that...
Screening resumesCommunication skillsRecruitment processesScheduling interviewsOnboarding new hiresMaintaining employee recordsUpdating databasesStrong writing skills

Social Media and Community Manager
Mitti - Organic Fresh Desi 2.00 to 6.00 Years Indore,Other Madhya Pradesh 01 Apr, 2025

Company Description Mitti - Organic. Fresh. Desi. is an Organic Indian Bistro focused on providing healthy and conscious food options to its customers. The menu offers a variety of Indian vegetar...
Social Media ManagementContent CreationCommunity EngagementCustomer Relationship ManagementDigital MarketingInterpersonal SkillsGraphic DesignOnline Brand PromotionExcellent CommunicationKnowledge of Indian CuisineKnowledge of Organic Food Indus

Agency Manager - Health Insurance
Skill Sphere Placement Services Hiring For Niva Bupa Health Insurance 1.00 to 6.00 Years Indore,Ujjain, Jabalpur, Bhopal, Chhindwara, Raipur, Alwar, Ludhiana, Ambala, Raigarh 01 Apr, 2025

Profile: Unit Manager / Agency Manager / Business Development Manager Vertical : Agency CTC Offered :up to 4.5 LPA Incentives allowances agency channelinsurance salesgeneral insurancefield saleschannel partnershealth insuranceagency developmentbusiness development

Customer Care Representative
Witbloom Training and Placement 0.00 to 1.00 Years Indore 01 Apr, 2025

Job Title: Customer Support Executive Domestic Voice Process Job Location: Indore ] international call centercustomer servicevoice processdomestic bposolving queriesbpograduatecustomer relationshipundergraduate

Sales Team Coach
ICICI LOMBARD GENERAL INSURANCE CO LTD 3.00 to 8.00 Years Indore 01 Apr, 2025

Job description Designation - Sales Team Coach

sales operationsleadership skillsoutbound salesteam handlingtelesalescall center operationstarget achievementverbal communicationsales support

Hr Executive
H I R E 1.00 to 6.00 Years Hyderabad 01 Apr, 2025

Greeting from H I R E! Hiring for the following Job Vacancy :HR Executive Key Responsibilities 1. Provide support for recruitment efforts, including job postings, interviewing, and onboarding....
interview schedulingemployee engagementonboardingpostingrecruitment

Regional Sales Manager-Project sales( construction chemicals)
MEGMA SERVICES 12.00 to 20.00 Years Hyderabad,Bangalore, Chennai 01 Apr, 2025

Global construction chemical brand requires Regional sales Mgr ( Project sales)- Bangalore /Chennai/Hyderabad One of our client aGlobal construction chemical MNC aa 100% subsidiary o...
project sales headconstruction chemical sales

Female Fresher School Teacher in DPS Public School
RENOVISION TECHNOLOGY 0.00 to 1.00 Years Hyderabad,Bangalore, Cuttack, Amritsar, Jalandhar, Pune, Delhi, Dalhousie, Vadodara, Guwahati 01 Apr, 2025

Key Responsibilities:

teacher trainingeducational consultingteachingschool teacherteacherclass teacher

Account Management Director
SPENTO PAPERS (INDIA) LLP 12.00 to 22.00 Years Hyderabad,Bangalore, Noida, Chennai, Gurugram, Kolkata, Pune, Tadepalligudem, Mumbai City, Delhi 01 Apr, 2025

We are seeking an experienced Account Management Director to lead and optimize our Account Management team. This leadership role will focus on driving customer success and revenue growth, ensuri...
medicaresalesservicemedicaidcustomerbusinessdevelopmentoversightprocessimprovement

Pre Sales Executive
DIGITALCUBE CONSULTANCY SERVICES PRIVATE LIMITED 1.00 to 3.00 Years Hyderabad,Delhi 01 Apr, 2025

Designation:Pre-Sales Executive Experience Required:6month to 2years Location: presalestele sales

Costumer Support
Hucon Solutions India PvtLtd 0.00 to 4.00 Years Hyderabad 01 Apr, 2025

dear job seekers, Greetings from Hucon Solutions. Spot offers with Immediate Joining !! Drive for Customer Support for Top MNCs Eligibility : * Any Graduate,PG,UG * Exp : Min 1 year experie...
international bpooutbound sales

Business Development Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 8.00 to 12.00 Years Hyderabad,Bangalore, Noida, Chennai, Gurugram, Pune, Mumbai City, Delhi 01 Apr, 2025

Key Responsibilities:

Strategic Planning: Develop and execute strategic business development plans that align with company goals and target ma...
sales growthanalysismarket analysisadaptabilityadministration workmarketcommunicationstrategic planningstrategic thinkinginnovationnegotiationcontractsresearch

Tele Sales Executive
XIPHI INSIGHTS PRIVATE LIMITED 1.00 to 2.00 Years Gurugram 01 Apr, 2025

A Real Estate Telesales job description typically involvesgenerating leads, making outbound calls to potential clients, presenting properties, and closing sales deals, all whi...
communication skillscallinginternational

Academic Counsellor
Ksirius Consultants Hiring For Aimlay and IIDE 1.00 to 4.00 Years Gurugram,Delhi, Noida, Ambernath, Thane, Mumbai City, Dombivali 01 Apr, 2025

Responsibilities: Contact prospective customers through inbound leads follow up on calls and emails (leads are provided). Converting the leads via Outbound calls Explaining the services and conve...
outbound salesacademic consultinginside salescounsellor

Telecaller
THE TALENT KEEPERS 2.00 to 7.00 Years Gurugram 01 Apr, 2025

URGENT HIRING ! Profile-Telecaller Executive Company- Real Estate Location- Gurugram ROLES & RESPONSIBILITIES
customer careinbound processbpotelecallingcalling

Chat Support Executive
JDM CONSULTANCY 1.00 to 5.00 Years Gurugram,Delhi 01 Apr, 2025

Dear Candidate, We have Urgent Hiring for Chat Executive in IGT Solutions : Roles and Responsibilities : _Develop and implement e-commerce st...
chat processnon voicecustomer servicebpoemailemail processchatbackend operations

Required Tele Caller Dayshift
Sharda Consultancy Services 0.00 to 2.00 Years Gurugram,Delhi, Noida 01 Apr, 2025

Required Female Tele Caller for outbound domestic process.Good communication skills Salary - upto 15k working days - 6 days (Sunday off ) Shift Time - 10 AM to 7 pm Salary date...
outbound marketingdomestic bpotelesalesbposales

Sr HRBP Associate -Gurugram
MEGMA SERVICES 3.00 to 6.00 Years Gurugram 01 Apr, 2025

Leading engineering and construction company requires Sr HRBP Associate - Gurugram One of our client luxury brand which is Indias leading manufacturer of premium doors, windows, wood house and t...
hr operationshrbpassociate

Tele Caller
Synergy Plus Business Consulting Group 0.00 to 1.00 Years Gurugram 01 Apr, 2025

Job Title: Tele caller Location:Gurgaon Experience: 0-2...
bpolead generationcustomer relationship

Lead Generation Expert
Team Vertex India Global Services Private Limited Hiring For Lead Generation Expert 1.00 to 5.00 Years Gurugram,Delhi 01 Apr, 2025

Job Title: Lead Generation Expert Location: Gurgaon Job Summary: We are looking for a proactive and results-driven Lead Generation Expert to ...
voice processinternational call centertelecom salesinternational salesinternational bpoverizonatnt

Marketing Executive
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Bhagalpur, Hyderabad, Pune, Patna, Guwahati 01 Apr, 2025

Marketing executives coordinate and oversee campaigns geared at promoting products, services, and causes. Marketing executives are adept at a variety of platforms, including print and social med...
marketing researchmarketing communicationmarketing managementbrand managementmarketing

Hiring For Online Marketing Executive (Work From Home Or Office Both) DELHI-NCR
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 01 Apr, 2025

Dear Candidate Greetings fromDesnor Destination Pvt Ltd ! Job Summary Idealises Internet Marketing Agency is looking for Marketing Executive to join our dynamic team and embark on a rewarding...
marketing planningdigitaldisplay advertisingmarketingfreelancingwork from homemarketing communicationpart time

Phone Banking Officer
EBIXCASH GLOBAL SERVICES PRIVATE LIMITED 0.00 to 1.00 Years Noida 01 Apr, 2025

Payroll Company Name : - Ebixcash Global Services. www.ebixcashglobalservices.com Were hiring Male / Female Fresher and experienced candidates for Ebixcash Process ( Customer ...
tamil speakingtelugukannadatele sales excecutive

German Language Specialist
Wroots Global Private Limited 1.00 to 6.00 Years Gurugram,Jaipur 01 Apr, 2025

Job Title: German Language Specialist International Voice Support Location: Jaipur & Gurgaon voice supportinternational voicecall centre voiceinternational bpogerman translationvoice processcustomer care

Account Management Director
SPENTO PAPERS (INDIA) LLP 12.00 to 22.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Tadepalligudem, Mumbai City 01 Apr, 2025

We are seeking an experienced Account Management Director to lead and optimize our Account Management team. This leadership role will focus on driving customer success and revenue growth, ensuri...
medicaresalesservicemedicaidcustomerbusinessdevelopmentoversightprocessimprovement

Chief Talent Officer
SPENTO PAPERS (INDIA) LLP 25.00 to 0.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Itanagar 01 Apr, 2025

We are looking for a Chief Talent Officer who will support our talent acquisition and development activities. You will implement regular performance evaluations and be in charge of our employees...
engagementeeosystemhrispayrolldevelopmentorganizationplanningemployeesuccessionexcellentworkforceinterpersonalstrategic

Business Development Manager
ADITYA BIRLA SUN LIFE INSURANCE COMPANY LIMITED 1.00 to 2.00 Years Gurugram,Delhi, Faridabad, Ghaziabad 01 Apr, 2025

Designation:Agency Manager Education:Any Graduates Experience:Fresher with Good network / Min. 1 Yearin anyDomain Sal...
salesinsuranceagency channelbfsi sales

Brand Manager
MNR Solutions Pvt Ltd 10.00 to 16.00 Years Gurugram 01 Apr, 2025

Brand Manager Key Responsibilities: Develop and execute comprehensive brand strategies and marketing plans, collaborating with the founders to drive brand growth and strengthen market presence...
brand managementbrand marketingbrand planningbrand campaigns

NTT DATA Virtual Drive Hedge Fund Gurgaon
NTT DATA INFORMATION PROCESSING SERVICES PRIVATE LIMITED 1.00 to 3.00 Years Gurugram 01 Apr, 2025

NTT DATA is Hiring experienced candidates for Hedge Fund Accounting domain. Location:Gurgaon Sector 48 (Candor Techspace) Work from Office Only Shift ...
reconciliationhedge fundsnav calculationinvestment banking

PREV
NEXT

outbound engagement Job Openings

Key Responsibilities:

Job Summary:

Key Responsibilities:

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers