recruiting marketing jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

recruiting marketing Job Openings

Showing 25151 - 25200 of 32227 Jobs

Sales Manager - SME LAP with Top NBFC

the bencHmaRk services 4.00 to 8.00 Years Hyderabad 01 Apr, 2024

Relationship Management

Portfolio Management

Customer Service

Loan Against Property

UX/UI Designer

NEUMERIC TECHNOLOGIES PVT LTD 3.00 to 8.00 Years Hyderabad 01 Apr, 2024

Title:UX/UI Designer

Job Type: Full Time Location: Dilsukhnagar/Gachibowli, TS Experience: 3-8 years

Key Responsibilities:

Key Respons...
mobile interfacesdrupalux designmobile web designdotnetnukeweb designingcss3html5

Executive
HiGlance Laboratories Pvt Ltd 2.00 to 6.00 Years Noida 01 Apr, 2024

Company Description HiGlance Laboratories Pvt Ltd is a pharmaceutical company located in Noida, Uttar Pradesh, India. We specialize in the development and manufacturing of pharmaceutical products...
Product ManagementMarket ResearchCompetitor AnalysisSales SupportForecastingTrainingDevelopmentBrand PositioningMarketing Strategies

Inside Sales Specialist
Tyresnmorecom 2.00 to 3.00 Years Delhi 01 Apr, 2024

About us Tyresnmore.com is on the path to become Indias 1st and Largest Brand name in Auto After care products and service experience delivered at your doorstep. We currently operate in Delhi- NC...
SalesCustomer ServiceInbound CallsUpsellingOrder ProcessingCustomer Relationship ManagementTime ManagementMicrosoft OfficeLanguage SkillsCommunication SkillsOutbound Calls

Car Sales Specialist
Rohan Motors Ltd 2.00 to 6.00 Years Delhi 01 Apr, 2024

Company Description Rohan Motors Ltd is a leading automotive dealership located in New Delhi. Our mission is to prioritize customer satisfaction by integrating sales, service, and parts under one...
Sales ConsultingAutomotive Sales

Sales Executive
Q Po India 2.00 to 6.00 Years Delhi 01 Apr, 2024

Company Description Q Po India is your trusted partner for automotive interior protection and enhancement. We specialize in precision engineering and are known for creating industry-leading car f...
SalesCommunicationNegotiationInterpersonal SkillsCustomer Service

Sales And Marketing
Sanskar HR Consultancy Services Hiring For Kesaria Rubber Industries Ltd 5.00 to 8.00 Years Gurugram 01 Apr, 2024

Designation Assistant Manager Department Sales & Marketing Grade/Level MM-01/AM Reporting Authority: Sales Unit Head Location Gurugram Job Summary: We are seeking a skilled and knowledgeable Assi...
telephonic team-leading skillshonesty integrityexcellent verbal written communication skills.strong persuasions skills computer skills

Sales And Marketing
Wood Kraft India 2.00 to 7.00 Years Delhi 01 Apr, 2024

As a Sales Executive, you will be responsible for driving sales and revenue growth by identifying potential clients, building strong relationships, and effectively communicating the value proposi...
marketingbusiness-to-businessmarketing leadershipb2b marketinglead scoringalignment

Sales & Marketing Manager
1.00 to 6.00 Years Delhi 01 Apr, 2024

Company Overview: Patronus Marketing Management is a 360-degree marketing agency founded by individuals who recognized the need for fresh and distinct marketing strategies in todays competitive m...
salessellingsales process

MARKETING MANAGER
C Suresh Hiring For fastlinkhr 4.00 to 9.00 Years Delhi 01 Apr, 2024

We are hiring marketing manager, Requirements needed

Candidate should haveminimum 5 years experience in Education industry(preferable overseas education)

Age- below 40 y...
overseas educationeducational marketingoverseas marketing

Digital Marketing Executive
Inspiretech Realty Pvt Ltd 2.00 to 6.00 Years Noida 01 Apr, 2024

Company Description Inspiretech Realty Pvt. Ltd. is a flourishing Real Estate Consulting firm based in Noida. We specialize in both Residential and Commercial Property in Delhi/NCR. Our mission i...
Social Media MarketingMarketingCommunication skillsWeb Content Writing skillsWeb Analytics proficiencyExcellent writtenverbal communication skills

Digital Marketing Manager
BOP GROUP 2.00 to 6.00 Years Noida 01 Apr, 2024

Company Description BOP GROUP, also known as BOP, is one of the biggest and finest real estate consultants in Delhi-NCR. We specialize in providing quality housing and commercial space to meet th...
Social Media MarketingMarketingLead GenerationWeb AnalyticsDigital MarketingAnalytical SkillsWritten CommunicationVerbal Communication

Travel Sales Executive
Venus Solutions Point Hiring For Venus Solutions Point 0.00 to 4.00 Years Delhi 01 Apr, 2024

Post -: Travel Sales Executive Salary -: 10000/- to 25000/- Job Location -Janak Puri and Dwarka Sec-7, New Delhi Exp. -: Max 1 ...
tour packagestravel coordinationtravel assistancetour marketingtour developmenttravel salessales operational planning

Tour Package Executive
Venus Solutions Point Hiring For Venus Solutions point 2.00 to 4.00 Years Delhi 01 Apr, 2024

We have an urgent requirement for Tour Package Executive. Job Description Basic Knowledge of selling Tour Packages, Destination Booking Domestic OR International Packages Responsible for gene...
back-end operationstour packagestravel consultingsales coordinationtravel marketingtravel salesholiday packages

Area Sales Manager
KYKCorp India Pvt Ltd 3.00 to 8.00 Years Delhi 01 Apr, 2024

1-Bachelors degree and MBA preferred 2- Two to three years of experience in sales and Marketing 3-Achieving Monthly and Yearly Sales Target. 4- Good Communication Skill.
...
communication skillssalesdirect sales

International Travel sales
CAREER MISSION 1.00 to 5.00 Years Gurugram 01 Apr, 2024

Position Title: International Travel Sales Experience- 6months Location- Gurugram Salary- 37k 15k incentive We are seeking a dynamic and results-oriented International Travel Sales Consultan...
travelsales

sales and marketing manager
business interface 2.00 to 6.00 Years Delhi 01 Apr, 2024

Regular visits customers- Digital Printers, Paper Converter, Publishing, and Packaging. Generate orders, customer outstanding, travelling outstations. To be responsible for successful delivery ...
marketingsales

sales coordinator
business interface 2.00 to 6.00 Years Delhi 01 Apr, 2024

Regular visits customers- Digital Printers, Paper Converter, Publishing, and Packaging. Generate orders, customer outstanding, travelling outstations. To be responsible for successful delivery ...
salescustomermarketing

Business Development Executive
Netambit ValueFirst Services Private Limited 3.00 to 8.00 Years Noida 01 Apr, 2024

Urgent hiring forBusiness Development Executive L&TSufinprofile forNoidalocation. Please find the job details as below:- Compa...
upsellingsales presentationscross sellingsalesfield sales executivesales representativebuyer onboarding

Business Development Manager for Phase-3 Ghaziabad
OM Sai Management Consulting Services 3.00 to 8.00 Years Ghaziabad 01 Apr, 2024

Required Designation:- Business Development Manager Educational Qualification :- Should have MBA degree from reputed Institute Salary :- 40-50 K Per Mo...
business developmentb2b marketingdirect salescold callingoutbound callingsalesmarketing

Urgent Hiring For Hr Recruiter (BDE) (Work From Home )
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Delhi 01 Apr, 2024

Dear Candidate Greetings fromDesnor Destination Pvt Ltd ! Job Summary We are looking for an enthusiastic Human Resources (HR) Executive/Recruiter to implement a variety of human resource progr...
data entryonline marketingwork from homepart timefreelancingpromotionshr recruiter

Regulatory Affairs Specialist
TECHNO ENDURA 0.00 to 2.00 Years Delhi 01 Apr, 2024

Regulatory Affairs Specialist Job Description Responsibilities:

Prepare and submit regulatory documentation for new and existing medical products,including drugs,devices,and biol...
regulatory requirementsregulatory mattersregulatory guidelinesregulatory affairs

Sales & Marketing Manager
TEKPILLAR 2.00 to 4.00 Years Mohali 01 Apr, 2024

Hiring for Agency Manager :

To recruit good quality prospective insurance advisors and ensure that they are actually acquiring licensing

M...
marketingfield salesbankingbfsifinanceagency salessalesinsuranceloan

Hiring Sr.Agency Development Manager top 5 Life insurance
Niyukti Management Consultants Hiring For max life 5.00 to 10.00 Years Chandigarh 01 Apr, 2024

Top 5 Life Insurance Comp. PostSr.Agency Development Manager Salary up to 6.50Lac Location Delhi/Ncr, Noida, Gorgaon ,Faridabad,Gahzibad,Luck...
health insuranceagency salesgeneral insurancesaleslife insuranceagency development managerunit managerarea sales managersr.sales managersales executiveagency managerbusiness managerterritory managerrelationship managersales managerchief bus

Hiring For Sales Agency Development Insurance
Niyukti Management Consultants Hiring For Niyukti Management Consultants 4.00 to 9.00 Years Chandigarh 01 Apr, 2024

Required Agency Development Manager Life Insurance Co. Ltd. Location Delhi, Noida, Gurgram, Faridabad, Ghaziabad, Chandigarh, Ludhiana. Amritsar, Panchkula, ko...
insurancedirect marketingsalesagency salesinsurance salesbusinessdevelopmentchannelagency managersales officer

Urgently hiring || Packages Sales ||Travel Sales ||Holiday Executive
Venus Solutions Point Hiring For Venus Solutions Point 1.00 to 5.00 Years Chandigarh 01 Apr, 2024

Role: Sales Support & Operations - Other Industry Type: Travel & Tourism Department: Sales & Business Development Employment Type: travel agent activitiestravel planningtourism marketingtravel salestravel agency operationstourism managementtravel processtour packagestravel management

Pharma HR Recruiter
Pharma Company 10.00 to 14.00 Years Chandigarh 01 Apr, 2024

Looking for a Pharma-specific recruiter to fill technical and marketing positions for a pharma company. If you have additional skills like payroll management and coordination, it will help, but ar...
Payroll managementCoordinationPharmaspecific recruiterTechnical positions

Medical Representative (Pharma)
Himscout Recruiters 1.00 to 6.00 Years Mohali 01 Apr, 2024

Responsible forSales Of Branded Generic Healthcare Formulation at the Stockist, wholesaler, and Retail Levels.

The candidate will be responsible for making sales and maintainin...
b2b salespharma salespharma marketingbusiness developmentsalesmedical

Sales Executive
Himscout Recruiters 1.00 to 6.00 Years Chandigarh 01 Apr, 2024

Responsible forSales Of Branded Generic Healthcare Formulation at the Stockist, wholesaler, and Retail Levels.

The candidate will be responsible for making sales and maintainin...
pharma salesmedical salesdirect salespharmaceutical salessales managementgeneric drugspharma marketing

MARKETING MANAGER
C Suresh Hiring For fastlinkhr 4.00 to 9.00 Years Chennai 01 Apr, 2024

We are hiring marketing manager, Requirements needed

Candidate should haveminimum 5 years experience in Education industry(preferable overseas education)

Age- below 40 y...
overseas educationeducational marketingoverseas marketing

Director Human Resources
Bhumi 5.00 to 9.00 Years Chennai 01 Apr, 2024

The Director of Human Resources at Bhumi should be a People leader who will own and implement the organisations talent management strategy for employees, fellows and volunteers. They will collabor...
People managementEngagementNetworkingSupervisory skillsLeadership skillsAdaptabilityHRISListeningOrganizational skillsAttention to detailPrioritizationDelegationKnowledge of employment lawsMicrosoft Office Suite

We are Hiring For Immigration consultant
A V Immigration and careers consultancy private limited 1.00 to 5.00 Years Chennai 01 Apr, 2024

Provide consultation services to address potential clients interest in Visas, including establishing the suitability of the candidates visa. The consultation will mainly be by email, telephone, a...
marketinginternationalbusiness developmentsales coordinationsalesdomestic sales

Face to Face Fundraising Executive
ChildFund India 0.00 to 3.00 Years Chennai 01 Apr, 2024

SUMMARY Face-to-face fundraisers play a crucial role in actively engaging the public and garnering financial support for ChildFund Indias programs. Your primary responsibility ...
fundraisingcommunication skillsresource mobilizationdeal closuresales presentations

3D Visualizer
Shilpa Architects Planners Designers 1.00 to 5.00 Years Chennai 01 Apr, 2024

Architectural Visualizer (Junior - Mid level) About Us: Shilpa Architect is a dynamic and innovative architecture firm known for its commitment to design excellence and sustainable solutions. Wi...
3D ModelingRenderingCollaborationAutoCADSketchUp3ds MaxRevitVRayLumionAdobe PhotoshopAfter EffectsTexturingLightingPostProductionDeadline ManagementContinual Learning

Area Manager
Market Xcel Data Matrix Pvt Ltd 3.00 to 7.00 Years Chennai 01 Apr, 2024

Company Description Market Xcel Data Matrix Pvt. Ltd. is a full-service market research firm headquartered in India, with experience across diverse industries. We provide customized market resear...
Project ManagementLeadershipMarket ResearchData AnalysisCommunicationPresentationMS Office

Banking Operations
DIRAA HR SERVICES 0.00 to 4.00 Years Chennai 01 Apr, 2024

we are hiring candidates for banking operation role(clerk,teller,assistant manager), no sales and marketing Managing client bank accounts, including opening and closing accounts, and overseeing ...
opening new accountsteller operations

NRI-RM & Acquisition NR-RM
Acura Solutions Hiring For Reputed Bank 3.00 to 8.00 Years Chennai 01 Apr, 2024

Job Title: NRI-RM & Acquisition NR-RM for a reputed Pvt Bank Industry: Banking Qualifications: Graduate Functional Area: Sal...
nri servicesfield salesrelationship managementsalescustomer acquisition

Account Supervisor
MILLENNIUM BABYCARES PRIVATE LIMITED 14.00 to 23.00 Years Chennai 01 Apr, 2024

We are looking for an Account Supervisor to lead our account team and oversee our clients marketing campaigns and plans. In this role, you should be an excellent communicator and effective leade...
financial analysistaxationaccountingcompliancepayrollquickbooksbudgetingforecastingexcel

Product Sales Executive in Chennai (Non IT )
HR Inc Consultants 1.00 to 3.00 Years Chennai 01 Apr, 2024

We are hiring for Product Sales Executive for one of our leading clients from Chennai. The person as Product Sales Executive will be responsible for all presales, sales and post sales activities. ...
Knowledge of Industry segmentstheir primary activitiesStudyPreparation for salestechnicallycommerciallyVerbalwritten communication skillsPresentation skills to position companyproduct solution to prospectsMustering internalexternal support needed

Sales Executive-Chennai
Bhoruka Extrusions 3.00 to 5.00 Years Chennai 01 Apr, 2024

1. Candidate: Skills: Problem Solving, Good Communication, Critical and creative Thinking. Personality: Dynamism, Synergetic, Responsibility, Sense of Humour, Resourcefulness. Attitude: Go-gett...
Problem SolvingGood CommunicationCritical

Regulatory Affairs Specialist
TECHNO ENDURA 0.00 to 2.00 Years Chennai 01 Apr, 2024

Regulatory Affairs Specialist Job Description Responsibilities:

Prepare and submit regulatory documentation for new and existing medical products,including drugs,devices,and biol...
regulatory requirementsregulatory mattersregulatory guidelinesregulatory affairs

Urgent Opening Cluster Head Admission
A S Group 7.00 to 12.00 Years Bangalore 01 Apr, 2024

A.S. Group is currently hiring for one of the leading International School Management located in Pen India Job Details are as follows:- Designation: Cluster Head Location: Bengaluru Experienc...
admission manageradmission headcluster admission managercluster admission

Vacant Sales Managers For FMCG, Pharma, OTC, Personal care
Adidev Herbals Pvt Ltd 1.00 to 6.00 Years Bangalore 01 Apr, 2024

Required Regional / Area Sales Managers / Business development manager/Sales Executives/ Beauty Parloursales executives to market Herbal, Beauty & Personal care products/Health care products, Ayu...
personal careskin carepharmaceutical salesfmcg channel salesanti-aging productscosmetics

Marketing Manager
MILLENNIUM BABYCARES PRIVATE LIMITED 13.00 to 23.00 Years Bangalore 01 Apr, 2024

An Email Marketing Manager utilizes email communication tools to market a company and increase brand awareness. They are experts in the usage of email communications and develop marketing strateg...
marketservicemarketinganalyticscampaignspowerpointcustomerresearchmanagementdigitalprojectntegratedstrong

Graphic Designer
EduGATE Engineering Academy 1.00 to 5.00 Years Ahmedabad 01 Apr, 2024

About us: EduGATE Engineering Academy EduGATE Engineering Academy is a leading GATE coaching institute of Gujarat founded by IIT Bombay alumni in 2013. Institute has trained more than 12000 stu...
Graphic DesignVideo ProductionVideo EditingContent CreationInnovation

Business Head
Gallops group 10.00 to 14.00 Years Ahmedabad 01 Apr, 2024

Company Description We suggest you enter details here. Role Description This is a full-time on-site role located in Ahmedabad for a Business Head in Automobile Dealership. The Business Head ...
SalesMarketingFinanceInventory ManagementCustomer ServiceBusiness GrowthRelationship BuildingCustomer SatisfactionLeadershipNegotiationAutomotive Market KnowledgeFinanceBudgeting

Talent Acquisition Manager
Bethel Group 5.00 to 9.00 Years Ahmedabad 01 Apr, 2024

Bethel Group is looking to hire for a *Talent Acquisition Manager* role for one of the leading luxury automobile brand. Job Location - Ahmedabad, Gujarat Budget - Upto 11 lpa Responsibilities: ...
Talent AcquisitionRecruitmentManpower PlanningSuccession PlanningSourcingInterviewingCandidate AssessmentCommunication SkillsNegotiation SkillsInterpersonal SkillsTeam HandlingTalent Pipeline ManagementRecruitment Process ImprovementIndustry

Assistant Manager In Banking Sector
TEKPILLAR 1.00 to 3.00 Years Ahmedabad 01 Apr, 2024

Join Our Team as Assistant Manager - Retail Liability Banking Department Are you passionate about driving sales and marketing initiatives in the BFSI domain Were on the lookout...
casasalesbankingfinancebfsifield salesmarketinginsurancelead generetion

Assistant Manager Business Development
Unison Globus 3.00 to 7.00 Years Ahmedabad 01 Apr, 2024

Company Description Unison Globus is a Florida-based company that has been catering to the needs of CPAs, EA, and Accounting professionals in North America, Australia, New Zealand, and Singapore ...
Business DevelopmentSalesClient Relationship ManagementAccount ManagementCommunicationInterpersonal SkillsAnalytical SkillsMicrosoft OfficeProblemSolving SkillsFinancial KnowledgeAccounting KnowledgeTax Preparation Services

SALES EXECUTIVE CASHIER IN DUBAI
Always International Manpower Service Hiring For Accountant Data Entry Cashier Sales Job in Dubai 1.00 to 5.00 Years Vishakhapatnam 30 Mar, 2024

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Complying with all company,...
salessales processaccountingdocument controldata entrydata analysiscashier activitiescashiersaccount management

PREV
NEXT

recruiting marketing Job Openings

Regulatory Affairs Specialist Job Description Responsibilities: Prepare and submit regulatory documentation for new and existing medical products,including drugs,devices,and biol... regulatory requirementsregulatory mattersregulatory guidelinesregulatory affairs

Regulatory Affairs Specialist Job Description Responsibilities: Prepare and submit regulatory documentation for new and existing medical products,including drugs,devices,and biol... regulatory requirementsregulatory mattersregulatory guidelinesregulatory affairs

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Regulatory Affairs Specialist Job Description Responsibilities:

Prepare and submit regulatory documentation for new and existing medical products,including drugs,devices,and biol...
regulatory requirementsregulatory mattersregulatory guidelinesregulatory affairs

Regulatory Affairs Specialist Job Description Responsibilities:

Prepare and submit regulatory documentation for new and existing medical products,including drugs,devices,and biol...
regulatory requirementsregulatory mattersregulatory guidelinesregulatory affairs