segmentation strategies jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

segmentation strategies Job Openings

Showing 19751 - 19800 of 23790 Jobs

Sales Development Manager

TEKPILLAR 2.00 to 6.00 Years Mangalore 01 Apr, 2024

Job Title: Sales Development Manager - Banking Sector (Karnataka)

Responsibilities:

Develop and implement sales strategies to achieve business target...
b2bpharmabusiness developmentchannelb2clead generationbankingfield salesreal estate

Strategy Manager

Strivik Business Solutions Pvt Ltd 3.00 to 6.00 Years Navi Mumbai 01 Apr, 2024

business strategy

corporate development

strategic planning

business analytics

Practice Manager

MILLENNIUM BABYCARES PRIVATE LIMITED 10.00 to 20.00 Years Mumbai City 01 Apr, 2024

team management

front office

business process outsourcing

logistics coordination

management

supply chain operations

practice operations

property management systems

guest service management

manager

URGENT- Sales & Marketing Engineer (Export) position for Compressor exporter

Talent Corner HR Services Pvt Ltd 0.00 to 2.00 Years Mumbai City 01 Apr, 2024

Sales & Marketing Engineer (Export) position for Compressor exporting co

Talent Corner HR Services Pvt Ltd 0.00 to 3.00 Years Navi Mumbai 01 Apr, 2024

Business Development Manager

SkillDzire 1.00 to 3.00 Years Hyderabad 01 Apr, 2024

Sales

Market Analysis

Sales Strategy

Relationship Management

Area Sales Manager - Telangana

HARMAN International 8.00 to 10.00 Years Hyderabad 01 Apr, 2024

Sales

Business Development

Strategic Partnerships

Relationship Management

Market Analysis

Project Management

Retail Sales Strategies

Customer Liaison

Market Feedback

Executive

HiGlance Laboratories Pvt Ltd 2.00 to 6.00 Years Noida 01 Apr, 2024

Senior Engineer - Energy Advisory

WSP 7.00 to 10.00 Years Noida 01 Apr, 2024

Ethics and Compliance Analyst

WSP 1.00 to 3.00 Years Noida 01 Apr, 2024

Sales & Marketing Manager

1.00 to 6.00 Years Delhi 01 Apr, 2024

sales

selling

sales process

Digital Marketing Executive

Inspiretech Realty Pvt Ltd 2.00 to 6.00 Years Noida 01 Apr, 2024

Social Media Marketing

Marketing

Communication skills

Web Content Writing skills

Web Analytics proficiency

Excellent written

verbal communication skills

Digital Marketing Manager

BOP GROUP 2.00 to 6.00 Years Noida 01 Apr, 2024

Social Media Marketing

Written Communication

Verbal Communication

International Travel sales

CAREER MISSION 1.00 to 5.00 Years Gurugram 01 Apr, 2024

travel

sales

Business Development Executive

Netambit ValueFirst Services Private Limited 3.00 to 8.00 Years Noida 01 Apr, 2024

Business Development Executive L&T

Sufin

Noida

field sales executive

sales representative

buyer onboarding

Regulatory Affairs Specialist

TECHNO ENDURA 0.00 to 2.00 Years Delhi 01 Apr, 2024

Regulatory Affairs Specialist Job Description Responsibilities:

Prepare and submit regulatory documentation for new and existing medical products,including drugs,devices,and biol...
regulatory requirementsregulatory mattersregulatory guidelinesregulatory affairs

Medical Device Regulatory Affairs

TECHNO ENDURA 0.00 to 2.00 Years Delhi 01 Apr, 2024

Developing and implementing regulatory strategies for new and existing products
Pre...
regulatory strategy developmentregulatory mattersregulatory auditregulatory guidelinesmedical devicesregulatory affairs

Cost Accountant

Innova Captab Ltd 4.00 to 5.00 Years Panchkula 01 Apr, 2024

SAP FICO

Customer Care Representative

BHARTI HR CLEANER WALA ZEEVIKA JOBS Hiring For Optistaff Solution Private Limited 0.00 to 4.00 Years Panchkula 01 Apr, 2024

customer relationship

customer care

customer service management

customer support

customer service delivery

Medical Representative (Pharma)

Himscout Recruiters 1.00 to 6.00 Years Mohali 01 Apr, 2024

Responsible forSales Of Branded Generic Healthcare Formulation at the Stockist, wholesaler, and Retail Levels.
The candidate will be responsible for making sales and maintainin...
b2b salespharma salespharma marketingbusiness developmentsalesmedical

Sales Executive

Himscout Recruiters 1.00 to 6.00 Years Chandigarh 01 Apr, 2024

Responsible forSales Of Branded Generic Healthcare Formulation at the Stockist, wholesaler, and Retail Levels.
The candidate will be responsible for making sales and maintainin...
pharma salesmedical salesdirect salespharmaceutical salessales managementgeneric drugspharma marketing

Manager, Human Resources

Teach For India 2.00 to 5.00 Years Chennai 01 Apr, 2024

Performance Management

Face to Face Fundraising Executive

ChildFund India 0.00 to 3.00 Years Chennai 01 Apr, 2024

SUMMARY

fundraising

communication skills

resource mobilization

deal closure

sales presentations

Practice Manager

MILLENNIUM BABYCARES PRIVATE LIMITED 10.00 to 20.00 Years Chennai 01 Apr, 2024

team management

front office

business process outsourcing

logistics coordination

management

supply chain operations

practice operations

property management systems

guest service management

manager

Team Lead, Technology, Project Management, Corporate Banking; Lead...

DBS Bank 8.00 to 12.00 Years Chennai 01 Apr, 2024

Site Reliability Engineering

NRI-RM & Acquisition NR-RM

Acura Solutions Hiring For Reputed Bank 3.00 to 8.00 Years Chennai 01 Apr, 2024

Job Title

Industry:

Qualifications

Functional Area:

nri services

field sales

relationship management

sales

customer acquisition

Branch Manager

BETTER HIRE 6.00 to 10.00 Years Chennai 01 Apr, 2024

We are looking for a results-driven Branch Manager to ensure that sales goals are met and office tasks are completed successfully in a timely manner. Branch Managers are also responsible ...
branch managementbranch accountingaccounts finalisationbranch operationbranch bankingbranch administration

Branch Manager
BETTER HIRE 3.00 to 6.00 Years Chennai 01 Apr, 2024

We are looking for a results-driven Branch Manager to ensure that sales goals are met and office tasks are completed successfully in a timely manner. Branch Managers are also responsible ...
branch accountingbranch bankingaccounts finalisationbranch operationsbranch handlingbranch administration

Regulatory Affairs Specialist
TECHNO ENDURA 0.00 to 2.00 Years Chennai 01 Apr, 2024

Regulatory Affairs Specialist Job Description Responsibilities:

Prepare and submit regulatory documentation for new and existing medical products,including drugs,devices,and biol...
regulatory requirementsregulatory mattersregulatory guidelinesregulatory affairs

Medical Device Regulatory Affairs
TECHNO ENDURA 0.00 to 2.00 Years Chennai 01 Apr, 2024

Medical Device Regulatory Affairs Job duties of a Regulatory Affairs Specialist include:

Developing and implementing regulatory strategies for new and existing products

Pre...
regulatory strategy developmentregulatory mattersregulatory auditregulatory guidelinesmedical devicesregulatory affairs

Data Analyst (Power BI, Python, SQL)- Internal Audit domain, Bangalore
Talent Leads HR Solutions Pvt Ltd 3.00 to 8.00 Years Bangalore 01 Apr, 2024

Qualification- Mba Finance / Mca Experience 3 years Location Bangalore BO. 5.5 Days working from Office Key responsib...
sqlpowerdata analysisdatapython

Marketing Manager
MILLENNIUM BABYCARES PRIVATE LIMITED 13.00 to 23.00 Years Bangalore 01 Apr, 2024

An Email Marketing Manager utilizes email communication tools to market a company and increase brand awareness. They are experts in the usage of email communications and develop marketing strateg...
marketservicemarketinganalyticscampaignspowerpointcustomerresearchmanagementdigitalprojectntegratedstrong

Training Placement Officer
SKIPS University 5.00 to 9.00 Years Ahmedabad 01 Apr, 2024

Position Overview: As a Training and Placement Officer will play a pivotal role in connecting students with career opportunities by facilitating Students training, skill development, and eventual...
Strong communication skillsData managementStakeholder engagementDatabase managementNetworking abilitiesUnderstanding of student needsindustry requirementsCareer counselingMicrosoft Office SuiteKnowledge of industry trends

Teacher in D.A.V. School
RENOVISION TECHNOLOGY 0.00 to 1.00 Years Ahmedabad 01 Apr, 2024

Classroom teachers will be expected to:

have the content knowledge and pedagogical practice to meet the diverse needs of all students teacher trainingeducation policystudent disciplinecharter schoolsschool boards

Lead - Talent Management
Adani Group 15.00 to 19.00 Years Ahmedabad 01 Apr, 2024

Purpose of the role:- Reporting to the Group Head, Talent and Leadership Development, the Succession Planning & Assessment Leader will be responsible for developing a pipeline of ready-to-deploy,...
Succession PlanningTalent ManagementLeadership DevelopmentOrganizational PsychologyChange ManagementTalent Assessment

Business Head
Gallops group 10.00 to 14.00 Years Ahmedabad 01 Apr, 2024

Company Description We suggest you enter details here. Role Description This is a full-time on-site role located in Ahmedabad for a Business Head in Automobile Dealership. The Business Head ...
SalesMarketingFinanceInventory ManagementCustomer ServiceBusiness GrowthRelationship BuildingCustomer SatisfactionLeadershipNegotiationAutomotive Market KnowledgeFinanceBudgeting

Talent Acquisition Manager
Bethel Group 5.00 to 9.00 Years Ahmedabad 01 Apr, 2024

Bethel Group is looking to hire for a *Talent Acquisition Manager* role for one of the leading luxury automobile brand. Job Location - Ahmedabad, Gujarat Budget - Upto 11 lpa Responsibilities: ...
Talent AcquisitionRecruitmentManpower PlanningSuccession PlanningSourcingInterviewingCandidate AssessmentCommunication SkillsNegotiation SkillsInterpersonal SkillsTeam HandlingTalent Pipeline ManagementRecruitment Process ImprovementIndustry

Assistant Manager Business Development
Unison Globus 3.00 to 7.00 Years Ahmedabad 01 Apr, 2024

Company Description Unison Globus is a Florida-based company that has been catering to the needs of CPAs, EA, and Accounting professionals in North America, Australia, New Zealand, and Singapore ...
Business DevelopmentSalesClient Relationship ManagementAccount ManagementCommunicationInterpersonal SkillsAnalytical SkillsMicrosoft OfficeProblemSolving SkillsFinancial KnowledgeAccounting KnowledgeTax Preparation Services

Business Analyst Urgent Vacancy
RENUKA INTERPRISES 0.00 to 4.00 Years Vellore 30 Mar, 2024

We are hiring a business analyst to join our project team. You will work alongside other business analysts and report directly to the project manager. Your main tasks will include performing deta...
analysisdata analysissqlbusiness analysis

Hiring For Business Analyst
Divya Staffing Solution 0.00 to 4.00 Years Vellore 30 Mar, 2024

We are hiring a business analyst to join our project team. You will work alongside other business analysts and report directly to the project manager. Your main tasks will include performing deta...
project managementbusiness processsoftware testingdata analytics

Business Analyst Opening
Divya Staffing Solution 0.00 to 4.00 Years Vellore 30 Mar, 2024

We are hiring a business analyst to join our project team. You will work alongside other business analysts and report directly to the project manager. Your main tasks will include performing deta...
business processdata analyticssoftware testingproject management

Assistant Manager
Contrywide 3.00 to 5.00 Years Varanasi 30 Mar, 2024

Company Description We suggest you enter details here. Role Description This is a full-time on-site role for an Assistant Manager located in Varanasi. The Assistant Manager will be responsible ...
CommunicationInterpersonal skillsCritical thinkingMicrosoft OfficeProject managementTeam managementCollaborationStrong leadershipProblemsolvingDecisionmakingOrganizational skills

Territory Growth Manager
Ashirvad Pipes 3.00 to 7.00 Years Varanasi 30 Mar, 2024

Role Purpose: Responsible for managing sales of Ashirvads products in the defined geographic area and ensure consistent, profitable growth in sales revenues. Identify objectives, strategies and a...
Sales PlanningSales ExecutionSales StrategiesMarket AnalysisNegotiationChannel DevelopmentMarketing InitiativesTrade Promotion

Marketing Manager
IMS Learning Resources Pvt Ltd 3.00 to 7.00 Years Varanasi 30 Mar, 2024

Company Description IMS Learning Resources Pvt. Ltd. is a pioneering institution in management education training in India. Established in 1977, IMS has expanded into various sectors, providing t...
Market researchAnalytical skillsCommunication skillsProject managementDigital marketingMarketing strategiesProblemsolving skills

Branch Manager
DREAMS SOLUTIONS 5.00 to 10.00 Years Varanasi 30 Mar, 2024

Role/ Job Title: Branch Manager-Micro Business Loan Function/ Department: Micro Business Loans Job Purpose: The role entails scaling up the business for the M...
lapteam managementbusiness loanbranch managementunsecured loanspersonal loans

Data Analyst
CIEL HR 0.00 to 1.00 Years Vadodara 30 Mar, 2024

Job Title - Data Analyst Job Location - Vadodara, Gujarat CTC - Best in Industry Experience - 0-1 years (Freshers can apply) Job Role & Responsibility - Develop AI / ML solutions using data s...
data scienceadvanced analyticsdata miningSQLAWSPythonJava

International Chemical Sales Representative
Synergy Resource Solutions 4.00 to 7.00 Years Vadodara 30 Mar, 2024

Greetings from Synergy Resource Solutions, a leading HR Management Consultancy Firm. Our Client is an international food, fiberglass & chemical products Company Successfully Providing Distributi...
MarketingInternational SalesBusiness Development

Store Manager
Mohinder Singh Hiring For Farm 1.00 to 6.00 Years Udaipur 30 Mar, 2024

Responsibilities

Develop business strategies to raise our customers pool, expand store traffic and optimize profitability

Meet sales goals by training, motivating, mentori...
store managementstore operationsstores maintenanceassociate developmentstore keepingstore merchandising

Logistics Controller
Prime Placement Vision Pvt Ltd 0.00 to 4.00 Years Udaipur 30 Mar, 2024

A Logistics Controller, sometimes referred to as a Logistics Manager or Supply Chain Controller, is responsible for overseeing and managing all aspects of logistics and supply chain operations wi...
reverse logisticsthird-party logisticslogistics coordinationlogistics operationslogistics

ExportSales - Jodhpur
SANKALP PLACEMENTS INDIA LLP 5.00 to 10.00 Years Udaipur 30 Mar, 2024

A Reputed Export House offers an opportunity for Export Sales Manager for Jodhpur This Company is a Service Oriented Company which helps business utilize opportunities and growt...
export salesinternational salesexport marketing

PREV
NEXT

segmentation strategies Job Openings

Regulatory Affairs Specialist Job Description Responsibilities: Prepare and submit regulatory documentation for new and existing medical products,including drugs,devices,and biol... regulatory requirementsregulatory mattersregulatory guidelinesregulatory affairs

Regulatory Affairs Specialist Job Description Responsibilities: Prepare and submit regulatory documentation for new and existing medical products,including drugs,devices,and biol... regulatory requirementsregulatory mattersregulatory guidelinesregulatory affairs

Responsibilities Develop business strategies to raise our customers pool, expand store traffic and optimize profitability Meet sales goals by training, motivating, mentori... store managementstore operationsstores maintenanceassociate developmentstore keepingstore merchandising

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Regulatory Affairs Specialist Job Description Responsibilities:

Prepare and submit regulatory documentation for new and existing medical products,including drugs,devices,and biol...
regulatory requirementsregulatory mattersregulatory guidelinesregulatory affairs

Regulatory Affairs Specialist Job Description Responsibilities:

Prepare and submit regulatory documentation for new and existing medical products,including drugs,devices,and biol...
regulatory requirementsregulatory mattersregulatory guidelinesregulatory affairs

Responsibilities

Develop business strategies to raise our customers pool, expand store traffic and optimize profitability

Meet sales goals by training, motivating, mentori...
store managementstore operationsstores maintenanceassociate developmentstore keepingstore merchandising