solving institutions queries jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

solving institutions queries Job Openings

Showing 9901 - 9950 of 40914 Jobs

Laravel Developer

Param Software Fresher Rajkot, Gujarat 24 Sep, 2025

Microservices Architecture

Laravel Livewire

Inertiajs

Stock Audit Manager Retail Stores

Zion Corp Fresher Rajkot, Gujarat 24 Sep, 2025

Problemsolving skills

Attention to detail

Reporting skills

Retail stock management

Node.js Developer

R K Infotech Fresher Rajkot, Gujarat 24 Sep, 2025

Urgent requirement for Production Supervisor

sk online services Fresher Bhubaneswar, NashikNashik, Maharashtra, Odisha, Hyderabad, Nanded, Navi Mumbai, Thane, Ahmednagar, P 24 Sep, 2025

Company

Department

Location

Job Responsibil...
production managementproduction controlproductionproduction operationstestingmaterial handlingproduction planningteam leading

Sales Executive- Computer Showroom
Tanisha E- World Fresher Bhubaneswar 24 Sep, 2025

As a Sales Executive at Tanisha E-World, you will be a vital part of our team, specializing in high-performance PCs, laptops, gaming systems, and IT accessories. With a strong commitment to qualit...
SalesComputer HardwareCustomer ServiceRelationship BuildingPeripheralsCustomer ConsultationTechnical KnowledgeGaming SystemsSales TargetsComputer Components

Offshore vacancy 6g Arc Welder Required
Apex Offshore Services Fresher Cuttack, RajahmundryRajahmundry, Ernakulam, Idukki, Bellary, Pondicherry, Kollam, Jamshedpur, Kannur 24 Sep, 2025

Greetings we are hiring for the position of 6g Arc WELDER | Required with a leading Oil & Gas Industry Company. Job Responsibilities:
...
arc welding6g arc welder6g welderiti welderwelder

presales consultant
BSH TECHNOLOGIES PRIVATE LIMITED Fresher Bhubaneswar 24 Sep, 2025

Work closely with the Business Development & Sales teams to support lead qualification and opportunity conversion.

Conduct r...
crmpresentationsclientsmbsoftwaresalestoolsexcelpowerpointdemosmarketproposalsstrongmandatory.knowledgesystems.serviceslikeestimationsusing

Real Estate Developer
OVERNET TRADING PRIVATE LIMITED Fresher Kalahandi, DimapurDimapur, Bangalore, Bhagalpur, Chennai, Noida, Gurugram, Kolkata, Mumbai City, Zun 24 Sep, 2025

Real Estate Developers coordinate construction ability with investor needs, or they develop real estate based on customer requirements and market trends. Specific responsibilities of a Real Estat...
real estate investmentsreal estate salesreal estate constructionreal estate developmentestatereal estate - planningdeveloper

Administrative Executive
SHRI BALAJI ENTERPRISES Fresher Bhubaneswar, BaddiBaddi, Indore, Kolkata, Jamshedpur, Pune, Mumbai City, Vadodara, Ahmedabad, Guwaha 24 Sep, 2025

About the Role The Administrative Executive supports day-to-day office operations, facilitating efficient coordination among multiple departments. This role requires excellent organisational ...
communicationofficemanagementadaptabilitysupporttimeorganisationalskill

Customer Relationship Officer
Talent Acquaintance Fresher Ranchi, GandhinagarGandhinagar, Jaipur, Jabalpur, Raipur, Gurugram, Vishakhapatnam, Delhi, Bhopal, A 24 Sep, 2025

Immediate Openings BPO International Process (Voice, Chat & Email) Location: Jaipur Sitapura, Mans...
international voice processcustomer servicecommunication skillscustomer supportvoice processquery resolutioncustomer interactionnon voice process

Area Sales Manager
EDIFFY Fresher Ranchi, PatnaPatna, Jharkhand, Bangalore, Chennai, Hyderabad, Kolkata, Delhi, Bihar, Guwahati 24 Sep, 2025

Job Description Job Title: Area Sales Manager Pan India Department: Sales Location: Any Site of India Reports To: Director / CEO Job Summary: We are seeking a dynamic and results-driven Area Sale...
business developmentsales

Urgent Hiring Civil Site Engineer Fresher
Classic Enterprises Fresher Ranchi, GayaGaya, Hyderabad, Lucknow, Gurugram, Kolkata, Pune, Surat, Guwahati, Ahmedabad 24 Sep, 2025

Job Description Dear Job Seekers, Greetings of the day. We are recruiting for Civil Engineer Fresher can apply. only interested candidate send your resume or call to contact person. We have *...
autocadmonitoringconstructionsite engineeringms officecompliance monitoringcivil construction

Production Supervisor Dabur India Limited
sk online services Fresher Raipur, BilaspurBilaspur, Bijapur, Baloda Bazar, Bhillai, Korba, Raigarh, Chattisgarh, Bihar, Patna 24 Sep, 2025

Job description Contact info: 74,28,43,45,98 Were hiring2 Production Supervisorsto oversee our manufacturing operations. Your role involves managin...
production planningproduction operationslean manufacturingproduction controltestingmaterial handlingproductionproduction management

Customer Relationship Officer
Talent Acquaintance Fresher Raipur, JabalpurJabalpur, Bhopal, Gandhinagar, Jaipur, Gurugram, Vishakhapatnam, Ranchi, Delhi, Ahme 24 Sep, 2025

Immediate Openings BPO International Process (Voice, Chat & Email) Location: Jaipur Sitapura, Mans...
international voice processcustomer servicecommunication skillscustomer supportvoice processquery resolutioncustomer interactionnon voice process

Event manager
ASSETCARE SERVICES PRIVATE LIMITED Fresher Raipur, BangaloreBangalore, Purnia, Chennai, Ghaziabad, Hyderabad, Gurugram, Faridabad, Kakinada, Ch 24 Sep, 2025

An event managerplans, organizes, and oversees events like conferences, parties, and exhibitions, from initial concept and budgeting to on-site execution and post-event analys...
serviceleadershipmanagementnegotiationcommunicationcustomerbudgetingorganizationalskills

Executive Assistant
BEMCON ENGINEERING PRIVATE LIMITED Fresher Raipur, BilaspurBilaspur, Baloda Bazar, Bijapur, Durg, Dhamtari, Bhillai, Korba, Raigarh, Chattisgar 24 Sep, 2025

The Role We are searching for an exceptional Executive Assistant to support four senior sales leaders that report to our Chief Revenue Officer (...
timemanagementconfidentialitydiscretioncommunicationorganizational

Production Manager
RAJPUT PROTECTION SERVICE PRIVATE LIMITED Fresher Patna, BhagalpurBhagalpur, Bihar, Australia, Canada, Himachal Pradesh, Ahmedabad, Kuwait, Gwalior, I 24 Sep, 2025

We are looking for an experienced Production Manager to organize and oversee the manufacturing of goods. You will be ultimately responsible for the smooth running of all production lines and the ...
quality assurancemaintenanceproduct marketingproduction engineeringprocessproductionproduction management

Dot Net Developer
RAJKAMAL BARSCAN SYSTEMS PVT LTD Fresher Patna, KolkataKolkata, Bangalore, Chennai, Noida, Hyderabad, Gurugram, Pune, Mumbai City, Delhi 24 Sep, 2025

Software Developer (.NET|.NET Core) Experience: 2 Years Location: Andheri East, Mumbai and Remote ________________________________________ Key Skills

Technologies:...
mvc frameworkdesignproceduresdatabaseweb applications.net coremssqlstoredentity framework / ef corewindows applicationscustomer support / technical issue resolution.net developer

Data Science Trainee / Junior Data Scientist
Bloom Infotech Fresher Punjab 24 Sep, 2025

As a Data Science fresher, you will be part of our team where you will have the opportunity to apply your analytical and problem-solving skills on real-world datasets. You will collaborate closely...
PythonNumPySQLData VisualizationStatisticsProbabilityPandasScikitlearn

Customer Support Specialist
SATOPRADHAN PRIVATE LIMITED Fresher Amritsar 24 Sep, 2025

At Satopradhan, we are looking forCustomer Support Specialistsfor providing exceptional service and support to customers. Required Skills & Qualifications : call center operationscustomer supportcall center managementtelecallingcustomer service

Magento 2 Developer
Sookshum Labs Technologies Private Limited Fresher Punjab 24 Sep, 2025

As a Magento Developer at Sookshum Labs, your primary responsibility will be to develop, customize, and maintain Magento 2-based websites. You will collaborate closely with a team of developers to...
HTMLCSSJavaScriptAPIsjQueryPHPRESTSOAPUI DesignAWSGCPCommunication SkillsMagento Best PracticesRelational Database SystemsObjectOriented ProgrammingProblemSolvingOrganizational SkillsGIT Version Control

Equity Dealer(South)
Apex Services Hiring For One of the leading broking firm Fresher Mysore, GunturGuntur, Kochi, Nellore, Kozhikode, Vijayawada, Vishakhapatnam, Kakinada, Thrissur, Coi 24 Sep, 2025

Dear Candidate, Greetings From APEX SERVICES Designation- Assistant manager/Deputy manager Role- Equity Dealer brokingcross salesshare marketsecuritiesclient acquisitionequity advisorequity dealer

Business Process Optimization Manager
University of the People Fresher Mysore, Karnataka 24 Sep, 2025

As a Business Process Optimization Manager at University of the People (UoPeople), you will be responsible for leading and managing the optimization of business processes across the organization. ...
Business Process OptimizationProcess ImprovementLeadershipLeanSix SigmaBPMData AnalysisProject ManagementCommunication SkillsInterpersonal SkillsStrategic ThinkingAnalytical Abilities

District Manager
MNR Solutions Pvt Ltd Fresher Mysore, HosurHosur, Karnataka, Tamil Nadu, Gujarat, Chittorgarh, Rajasthan, Surat, Surendranagar, Er 24 Sep, 2025

Responsible for Sales and collection target achievement Expanding into new talukas Expanding franchisee network and increasing dealer share of wallet Ensuring marketing camp...
farmersdistrict sales managementchannel salesdealer sales

Solar PV Installation & Maintenance Trainer
DIDYU TECHNOLOGIES PRIVATE LIMITED Fresher Madurai, TiruchirappalliTiruchirappalli, Thanjavur, Erode, Coimbatore, Chennai, Salem, Sivakasi, Kri 24 Sep, 2025

Job Title: Solar PV Installation & Maintenance Trainer Location: Chennai solar pvstandardsmaintenanceinstallationprotocolssafetysolarsolar project field experience

Branch Manager
BN Recruitment Services Hiring For Bank Fresher Madurai, TiruchirappalliTiruchirappalli, Erode, Coimbatore, Vellore, Hosur, Nagercoil, Thiruvarur, T 24 Sep, 2025

Hiring For Banking:
Branch Management We are looking for a results-driven Branch Manager to ensure that sales goals are met and office tas...
decision-makingcommunication skillscustomer relationshipbranch operationsproblem solving

Sales Executive -Urgent Hiring
Planet Spark Fresher Madurai, AssamAssam, Bangalore, Arwal, Hyderabad, Vishakhapatnam, Karbi Anglong, Gurugram, Mumbai Ci 24 Sep, 2025

Job Location: Gurgaon (Full-time, On-site) Candidates must be willing to relocate.
communication skillsnegotiation skillsdomestic salessalesforceinternational salessales

Digital Marketing Specialist
Study Square Fresher Ludhiana, Punjab 24 Sep, 2025

Study Square is an international student placement consultancy providing comprehensive support to international students throughout their academic journey. From admission counseling to student vi...
SEOPPCSocial Media MarketingEmail MarketingContent MarketingDisplay AdvertisingGoogle AnalyticsAdWordsContent Management SystemsHTMLMarketing Automation Tools

Offshore vacancy 6g Arc Welder Required
Apex Offshore Services Fresher Idukki, KannurKannur, Kollam, Ernakulam, Cuttack, Rajahmundry, Bellary, Pondicherry, Jamshedpur, Kak 24 Sep, 2025

Greetings we are hiring for the position of 6g Arc WELDER | Required with a leading Oil & Gas Industry Company. Job Responsibilities:
...
arc welding6g arc welder6g welderiti welderwelder

Equity Dealer(South)
Apex Services Hiring For One of the leading broking firm Fresher Kakinada, GunturGuntur, Vishakhapatnam, Nellore, Vijayawada, Kochi, Kozhikode, Thrissur, Mysore, Coi 24 Sep, 2025

Dear Candidate, Greetings From APEX SERVICES Designation- Assistant manager/Deputy manager Role- Equity Dealer brokingcross salesshare marketsecuritiesclient acquisitionequity advisorequity dealer

Offshore vacancy 6g Arc Welder Required
Apex Offshore Services Fresher Kakinada, RajahmundryRajahmundry, Cuttack, Ernakulam, Idukki, Bellary, Pondicherry, Kollam, Jamshedp 24 Sep, 2025

Greetings we are hiring for the position of 6g Arc WELDER | Required with a leading Oil & Gas Industry Company. Job Responsibilities:
...
arc welding6g arc welder6g welderiti welderwelder

Workforce Services Senior Analyst (Capacity Planning)
Albireo Recruiters Hiring For Accenture Fresher Kakinada, GunturGuntur, Hyderabad, Kurnool, Nellore, Chittoor, Guntakal, Anantpur, Bangalore, Chenna 24 Sep, 2025

Role Workforce Services Senior Analyst (Capacity Planning) Responsible for developing and managing accurate mid to short-term Capacity planning models. These forecasts inform staffing, budgeting...
cross functional coordinationcapacity managementms excelshrinkage controlworkforce managementcontact centeroccupancy planningsla managementaht

Branch Operations Manager
PSS Consultant Fresher Kochi, ThrissurThrissur, Kottayam, Ernakulam, Idukki, Madurai, Bangalore, Chennai, Bellary, Coimbato 24 Sep, 2025

Pss Consultant Hiring For Banking Branch Operations Manager Description A Bank Branch Operations Manager oversees daily branch activi...
bankingbanking operationsoperations

Equity Dealer(South)
Apex Services Hiring For One of the leading broking firm Fresher Kakinada, GunturGuntur, Vishakhapatnam, Nellore, Vijayawada, Kochi, Kozhikode, Thrissur, Mysore, Coi 24 Sep, 2025

Dear Candidate, Greetings From APEX SERVICES Designation- Assistant manager/Deputy manager Role- Equity Dealer brokingcross salesshare marketsecuritiesclient acquisitionequity advisorequity dealer

Offshore vacancy 6g Arc Welder Required
Apex Offshore Services Fresher Kakinada, RajahmundryRajahmundry, Cuttack, Ernakulam, Idukki, Bellary, Pondicherry, Kollam, Jamshedp 24 Sep, 2025

Greetings we are hiring for the position of 6g Arc WELDER | Required with a leading Oil & Gas Industry Company. Job Responsibilities:
...
arc welding6g arc welder6g welderiti welderwelder

Workforce Services Senior Analyst (Capacity Planning)
Albireo Recruiters Hiring For Accenture Fresher Kakinada, GunturGuntur, Hyderabad, Kurnool, Nellore, Chittoor, Guntakal, Anantpur, Bangalore, Chenna 24 Sep, 2025

Role Workforce Services Senior Analyst (Capacity Planning) Responsible for developing and managing accurate mid to short-term Capacity planning models. These forecasts inform staffing, budgeting...
cross functional coordinationcapacity managementms excelshrinkage controlworkforce managementcontact centeroccupancy planningsla managementaht

Logistics Officer
SHARMA ENTERPRISES Fresher Kakinada, GunturGuntur, Hyderabad, Kurnool, Nellore, Guntakal, Anantpur, Dhubri, Dibrugarh, Guwahati 24 Sep, 2025

We are looking for a detail-oriented and organized Logistics Officer to join our team. The Logistics Officer will be responsible for coordinating the transportation, storage, and distribution of ...
supply chain managementcustomer serviceinventory managementproblem solvingadaptabilitylogistics managementdelivery operationsteamwork

Executive assistance
ASSETCARE SERVICES PRIVATE LIMITED Fresher Kakinada, HyderabadHyderabad, Ongole, Kadapa, Chittoor, Bangalore, Chennai, Gurugram, Kolkata, Delhi 24 Sep, 2025

An executive assistantprovides high-level administrative support to senior management by managing schedules, coordinating meetings, handling communications, preparing reports,...
communicationtechnicaldetailexperienceattentionproficiencyproblem-solvingorganizational

Senior Front End Developer .NET
Milestone Technologies, Inc Fresher Kochi, Kerala 24 Sep, 2025

We are seeking a highly skilled Senior Front-End Developer who excels in constructing contemporary, responsive, and high-performance web applications. The ideal candidate possesses expertise in va...
JavaScriptHTML5CSS3AngularRESTful APIsnpmyarnAzure DevOpsGitDebuggingCommunicationCollaborationMicrosoft Razor UINET MVCTypeScriptReactVuejsNET CoreNET 6WebSocket integrationWebpackViteCICD pipelines

Software Developer (Full Stack)
EY Fresher Kochi, Kerala 24 Sep, 2025

Role Overview: At EY, youll have the opportunity to build a unique career with global scale, support, inclusive culture, and technology to help you become the best version of yourself. Your unique...
SQLMicrosoft AzureAngularETL technologyMicrosoft Azure Data ServicesAzure Data FactoryDatabricksAzure Data Lake StoreDatabase conceptsData LakeWeb APIPowerBIPowerAppsPowerAutomatePMI

Customer Officer
VERTEX SECURITIES LIMITED Fresher Kochi, Kerala 24 Sep, 2025

As a Customer Care Team Lead, your primary role will be to oversee and guide the customer care team to provide exceptional service through various communication channels like phone, email, and cha...
Customer service managementLeadershipTeam managementCommunicationStock market operationsProblemsolvingInterpersonal abilitiesTrading platforms

Front Office Administrator
DLIFE Home Interiors Fresher Kochi, Kerala 24 Sep, 2025

As a detail-oriented and proactive professional, your role involves managing front office operations and assisting with daily administrative tasks. Your responsibilities include greeting and assis...
Administrative SupportCustomer ServiceCommunication SkillsProblem SolvingAdaptabilityOffice Operations ManagementMicrosoft Office SuiteOffice Management SoftwareOrganizational Abilities

Branch Operations Manager
PSS Consultant Fresher Kochi, ThrissurThrissur, Kottayam, Ernakulam, Idukki, Madurai, Bangalore, Chennai, Bellary, Coimbato 24 Sep, 2025

Pss Consultant Hiring For Banking Branch Operations Manager Description A Bank Branch Operations Manager oversees daily branch activi...
bankingbanking operationsoperations

Software Tester
Blue Horizon Infotech Fresher Kochi, Kerala 24 Sep, 2025

Role Overview: You have 2 years of experience in Software Testing Automation using Selenium. You are proficient in creating Test Automation Resources such as Function Libraries and have the abilit...
SeleniumTest AutomationTest DataTest CasesTest ScriptsSelenium WebDriverJavaInterpersonal skillsCommunication skillsSoftware Testing AutomationFunction LibrariesDataDriven TestingTestNG AnnotationsDefect Management ToolReRegression Testing

Pricing Specialist
HastenWay Shipping Fresher Kochi, Kerala 24 Sep, 2025

Role Overview: You will be responsible for preparing competitive freight rates, handling rate negotiations, and coordinating with carriers and agents to secure the best possible deals. The ideal c...
NegotiationAnalytical SkillsCommunication SkillsMS OfficeCustomer Service

Customer Service Quality Analyst
Chris Johnson Business IT Solutions Fresher Kochi, Kerala 24 Sep, 2025

As a Quality Analyst, your role will involve calibrating and supporting quality standards to ensure that quality and customer satisfaction goals are met in a timely manner. You will be responsible...
CRMCustomer ServiceInterpersonal SkillsVerbal CommunicationWritten CommunicationResearchAnalytical SkillsExcelTelecom experienceQuality AnalystProblemsolving Skills

Delivery Manager
SHARMA ENTERPRISES Fresher Kochi, ThrissurThrissur, Kollam, Ernakulam, Idukki, Kozhikode, Palakkad, Thiruvanananthapuram, Wayan 24 Sep, 2025

We are looking for delivery manager oversees the planning, execution, and successful delivery of a project or product, ensuring it meets timelines, budget, and quality standards. They act as a ce...
team managementproblem solvingproject executionstakeholder managementrisk managementproject planningquality assurance

Restaurant Captain
ALTSEO PRIVATE LIMITED Fresher Kochi, AnantnagAnantnag, Bangalore, Jalore, Jabalpur, Moga, Kavaratti, Hassan, Coimbatore, Tuensang 24 Sep, 2025

Job description 1. Supervise the functions of the department employees, facilities smooth operations on a daily basis. 2. Ensures clean & safe work environment for team & Customers. 3. 80...
order takingrestaurant managementsafety complianceinventory controlmenu developmentoperationsleadership skillsoperations managementorder accuracy

Application Sales Jodhpur (IVD)
ACCUREX BIOMEDICAL PRIVATE LIMITED Fresher Jodhpur, Rajasthan 24 Sep, 2025

As an Application Sales Specialist at Accurex Biomedical in Jodhpur, you will be responsible for providing clinical application support and driving sales in the IVD domain. Your role will involve...
Application SupportSalesMarket IntelligenceDiagnostic InstrumentsCustomer Queries

Production Manager
YOUTAG INFOTECH PRIVATE LIMITED Fresher Jodhpur, JaisalmerJaisalmer, Bhiwadi, Navi Mumbai, Bankura, Uttar Dinajpur, Thane, Mumbai City, Daks 24 Sep, 2025

We are looking for an experienced Production Manager to organize and oversee the manufacturing of goods. You will be ultimately responsible for the smooth running of all production lines and the ...
prosperitypressure transient analysismbalproduction managementproduction engineeringtechnical productionnodal analysis

PREV
NEXT

solving institutions queries Job Openings

About the Role The Administrative Executive supports day-to-day office operations, facilitating efficient coordination among multiple departments. This role requires excellent organisational ... communicationofficemanagementadaptabilitysupporttimeorganisationalskill

Job description Contact info: 74,28,43,45,98 Were hiring2 Production Supervisorsto oversee our manufacturing operations. Your role involves managin... production planningproduction operationslean manufacturingproduction controltestingmaterial handlingproductionproduction management

Hiring For Banking:

Branch Management We are looking for a results-driven Branch Manager to ensure that sales goals are met and office tas... decision-makingcommunication skillscustomer relationshipbranch operationsproblem solving

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

About the Role The Administrative Executive supports day-to-day office operations, facilitating efficient coordination among multiple departments. This role requires excellent organisational ...
communicationofficemanagementadaptabilitysupporttimeorganisationalskill

Job description Contact info: 74,28,43,45,98 Were hiring2 Production Supervisorsto oversee our manufacturing operations. Your role involves managin...
production planningproduction operationslean manufacturingproduction controltestingmaterial handlingproductionproduction management

Branch Management We are looking for a results-driven Branch Manager to ensure that sales goals are met and office tas...
decision-makingcommunication skillscustomer relationshipbranch operationsproblem solving