sql server queries jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

sql server queries Job Openings

Showing 4401 - 4450 of 17007 Jobs

Telesales Executive

Skywings Advisors Private Limited Fresher Mumbai City, PunePune, Kolkata 25 Sep, 2025

Profile - Tele sales Executive

Key Responsibilities:

Hiring for Customer service International Voice Process

Tech Mahindra Ltd Fresher Mumbai City 25 Sep, 2025

Customer service International Voice Process in Tech Mahindra Ltd

international bpo

customer support

inbound process

international voice process

communication skills

outbound calling

outbound sales

Customer Service Executive for Bangalore and Hyderabad with Top IT Companies

WHITE HORSE MANPOWER CONSULTANCY (P) LTD Fresher Hyderabad, Bangalore 25 Sep, 2025

Customer Service...
inbound callscustomer carecustomer supportvoice processcommunication skillscustomer serviceemail supportcustomer handlingchat support

Servicenow Developer
ITSOURCE GLOBAL SERVICES PRIVATE LIMITED Fresher Gurugram, BangaloreBangalore, Chennai, Hyderabad, Kolkata 25 Sep, 2025

Greetings, We are hiring for one of our clients, if you are intersted you can reach out to me on hidden_email Job description: 6 Years Experience ServiceNow Develo...
grcservicenow

Technical Architect Associate
Chetu India Pvt Ltd Fresher Noida 25 Sep, 2025

Job Summary We are looking for a Technical Architect Associate who will assist in designing, developing, and implementing scalable technology solutions using AI/ML, Python, Java...
intelligencejavascriptpythonjava

Java Backend Developer
MNR Solutions Pvt Ltd Fresher Chennai, Bangalore 25 Sep, 2025

Dear Candidates , Currently hiring for a Software Engineering IT Service and consulting Startup looking for Java Backend developer on direct payroll. Exp-4years NP-Imm...
spring mvchibernatemicroservicesspring bootjava

SAP Work Manager Developer
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Chennai, BangaloreBangalore, Noida, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi 25 Sep, 2025

SAP WorkManager: Primary Skill: SAP Work Manager Delivery Role: Sr. Developer Experience Profile: 06-10 years Candidate should have good knowledge and working experience of SAP Agentry/Work M...
spmmobile developmentjavasap work managerworkdevelopermanager

Travel Desk Executive
Bankai Infotech Fresher Ahmedabad, Gujarat 25 Sep, 2025

As a Travel Coordinator at our company, your role will involve booking travel arrangements for employees or clients, both domestic and international. You will be responsible for creating detailed ...
Travel arrangementsCustomer serviceBudget managementLogistics coordination

Walking for freshers & Exp Finance, Executive,Tax,Analyst Leading Clients
Wisdom Bridge Management Consultants Fresher Vijayawada, RajahmundryRajahmundry, Srikakulam, Vizianagaram, Ongole, Kadapa, Tirupati, Vishakhapatn 24 Sep, 2025

Preparing Tentative report by collating inputs from Business Team 2 Raising customer invoices in Excel & E-invoices in Govt. portal. 3 Coordination & follow ups with process heads for billing ...
invoice processingjournal entriesbrsfinancial reportingfinancial planninggstsales entryadvanced excelaccounts payable

Walking for freshers & Exp Finance, Executive,Tax,Analyst Leading Clients
Wisdom Bridge Management Consultants Fresher Vijayawada, RajahmundryRajahmundry, Srikakulam, Vizianagaram, Ongole, Kadapa, Tirupati, Vishakhapatn 24 Sep, 2025

Preparing Tentative report by collating inputs from Business Team 2 Raising customer invoices in Excel & E-invoices in Govt. portal. 3 Coordination & follow ups with process heads for billing ...
invoice processingjournal entriesbrsfinancial reportingfinancial planninggstsales entryadvanced excelaccounts payable

Sales Executive -Urgent Hiring
Planet Spark Fresher Vishakhapatnam, HyderabadHyderabad, Assam, Madurai, Bangalore, Arwal, Karbi Anglong, Gurugram, Mumba 24 Sep, 2025

Job Location: Gurgaon (Full-time, On-site) Candidates must be willing to relocate.
communication skillsnegotiation skillsdomestic salessalesforceinternational salessales

Backend .NET Developer
AppleTech Fresher Vadodara, Gujarat 24 Sep, 2025

As a Web Application Developer at AppleTechSoft, you will be required to have a minimum of 5 years of hands-on experience in developing web applications on the Microsoft Windows Platform and cloud...
Software DesignArchitectureREST APIOODAOPSQL ServerSQL QueriesJOINSDatabase DesignLINQDebuggingAnalytical SkillsJAVASCRIPTDOJODockerMicrosoft TechnologiesVerbal CommunicationWritten CommunicationMicrosoft Windows PlatformCloud Technolog

PHP & WordPress Developer
SEOWebPlanet Solutions - Digital Marketing Company in India Fresher Vadodara, Gujarat 24 Sep, 2025

As a WordPress Developer, you will be responsible for developing websites on WordPress based on the provided design with meticulous attention to detail. You will collaborate closely with the desig...
WordPressPSDHTMLHTML5CSS3JavaScriptPHPDebugging ToolsFigmaWordPress ThemingACF ProElementor

Sales Co-ordinator
MecPower Solutions Pvt Ltd Fresher Vadodara, Gujarat 24 Sep, 2025

As a Sales Coordinator, your primary role will be to support the sales team in enhancing their productivity and efficiency. This includes arranging appointments with customers, maintaining up-to-d...
OrganizationCustomer serviceOrganizingInterpersonal skillsPresentation skillsProblemsolvingMultitaskingSalesmarketing campaignsPrioritizingTeam playerDetailoriented

Customer Support Specialist
Live Connections Fresher Mumbai City 24 Sep, 2025

Job Title: Customer Support Associate International Voice Process Location: Malad, Mumbai Experience: Graduate Fresher OR HSC Minimum 1 Year of Experience (International Voice / Domestic Voi...
voice processcustomer supportcustomer service

Tele caller associate
Hinduja Global Solutions Limited (HGS) Fresher Thane, Navi Mumbai 24 Sep, 2025

Job Summary: We are seeking enthusiastic and motivated associated to promote banking products and services. This role involves building strong customer relationships, , understanding client needs...
callingcoldsalesoutboundprocessvoicetele

Customer Service Associate
Tech Mahindra Ltd Fresher Thane, Navi MumbaiNavi Mumbai, Mumbai City 24 Sep, 2025

Tech Mahindra- Hiring for Voice Process Key Responsibilities:

Voice Process

Provide Excellent customer service to clients across different time zones

Resolve custo...
cross sellingupsellingvoice processretentionoutbound callinginternational bpocustomercommunication skillsinternational voice process

SQL Developer
FYNXT Fresher Surat, Gujarat 24 Sep, 2025

Role Overview: As a skilled SQL Database Specialist, you will be responsible for designing, optimizing, and managing databases to support the business operations effectively. Your role will involv...
SQL Serverindexingquery optimizationcommunication skillsdatabase normalizationETL processescloudbased databasesbig data technologies

PHP Laravel Developer
Webiots Technologies Fresher Surat, Gujarat 24 Sep, 2025

As a PHP Laravel Developer at Webiots-Web Creators LLP in Adajan, Surat, you will play a crucial role in developing and maintaining web applications. With 3 to 4 years of experience, you will be r...
PHPLaravelHTMLCSSJavaScriptMySQLGit

District Manager
MNR Solutions Pvt Ltd Fresher Surat, SurendranagarSurendranagar, Gujarat, Tamil Nadu, Chittorgarh, Rajasthan, Hosur, Mysore, Karna 24 Sep, 2025

Responsible for Sales and collection target achievement Expanding into new talukas Expanding franchisee network and increasing dealer share of wallet Ensuring marketing camp...
farmersdistrict sales managementchannel salesdealer sales

Assistant Store Manager & Sales Assistant (Retail Stores)
Jobs Territory Hiring For Virgio Fresher Surat 24 Sep, 2025

Type: Full-time | Location: Surat Compensation: In-hand 18k-35k About the Role: Were seeking an energetic Assistant Store Mana...
stock controlcustomer servicestock replenishmentstore managementstaff schedulinginventory managementstore operationsvisual merchandising

District Manager
MNR Solutions Pvt Ltd Fresher Surat, SurendranagarSurendranagar, Gujarat, Tamil Nadu, Chittorgarh, Rajasthan, Hosur, Mysore, Karna 24 Sep, 2025

Responsible for Sales and collection target achievement Expanding into new talukas Expanding franchisee network and increasing dealer share of wallet Ensuring marketing camp...
farmersdistrict sales managementchannel salesdealer sales

Node.js Developer
R K Infotech Fresher Rajkot, Gujarat 24 Sep, 2025

As a Node JS Developer at our dynamic and fast-paced team dedicated to driving digital transformations, your role will involve: - Strong proficiency with JavaScript - Knowledge of Node.js and var...
JavaScriptHTMLCSSAJAXAngularJSPolymerClosureGit

.NET Developer
FinJo Fresher Khordha 24 Sep, 2025

You are an accomplished .NET Developer with over 4 years of professional experience, responsible for designing, developing, and maintaining enterprise web applications at client project sites. You...
SQL ServerOOPSOLID principlesJavaScriptjQueryHTML5CSS3AzureAWSGitAgile methodologyNET CoreNET FrameworkASPNET MVCWeb APIEntity FrameworkEF CoreRESTful services

presales consultant
BSH TECHNOLOGIES PRIVATE LIMITED Fresher Bhubaneswar 24 Sep, 2025

Work closely with the Business Development & Sales teams to support lead qualification and opportunity conversion.

Conduct r...
crmpresentationsclientsmbsoftwaresalestoolsexcelpowerpointdemosmarketproposalsstrongmandatory.knowledgesystems.serviceslikeestimationsusing

Customer Relationship Officer
Talent Acquaintance Fresher Ranchi, GandhinagarGandhinagar, Jaipur, Jabalpur, Raipur, Gurugram, Vishakhapatnam, Delhi, Bhopal, A 24 Sep, 2025

Immediate Openings BPO International Process (Voice, Chat & Email) Location: Jaipur Sitapura, Mans...
international voice processcustomer servicecommunication skillscustomer supportvoice processquery resolutioncustomer interactionnon voice process

Customer Relationship Officer
Talent Acquaintance Fresher Raipur, JabalpurJabalpur, Bhopal, Gandhinagar, Jaipur, Gurugram, Vishakhapatnam, Ranchi, Delhi, Ahme 24 Sep, 2025

Immediate Openings BPO International Process (Voice, Chat & Email) Location: Jaipur Sitapura, Mans...
international voice processcustomer servicecommunication skillscustomer supportvoice processquery resolutioncustomer interactionnon voice process

Dot Net Developer
RAJKAMAL BARSCAN SYSTEMS PVT LTD Fresher Patna, KolkataKolkata, Bangalore, Chennai, Noida, Hyderabad, Gurugram, Pune, Mumbai City, Delhi 24 Sep, 2025

Software Developer (.NET|.NET Core) Experience: 2 Years Location: Andheri East, Mumbai and Remote ________________________________________ Key Skills

Technologies:...
mvc frameworkdesignproceduresdatabaseweb applications.net coremssqlstoredentity framework / ef corewindows applicationscustomer support / technical issue resolution.net developer

Dot Net Developer
Ariel Software Solutions Fresher Punjab 24 Sep, 2025

You have an exciting opportunity to join our team as a Software Developer in Mohali, Punjab. With 1 to 4 years of experience, you will be responsible for creating top-quality applications and mana...
NETHTMLCSSJavaScriptAJAXjQueryBootstrapAngularJSSQL ServerMYSQLMongoDBPostgreSQLAutofacUnityNinjectNUnitXUnitMSTestNET languages CNET framework MVCNETWeb APIReactJSNET 45Net CoreEntity Framework 6EF CoreNHibernateADONETDepende

Customer Support Specialist
SATOPRADHAN PRIVATE LIMITED Fresher Amritsar 24 Sep, 2025

At Satopradhan, we are looking forCustomer Support Specialistsfor providing exceptional service and support to customers. Required Skills & Qualifications : call center operationscustomer supportcall center managementtelecallingcustomer service

Equity Dealer(South)
Apex Services Hiring For One of the leading broking firm Fresher Mysore, GunturGuntur, Kochi, Nellore, Kozhikode, Vijayawada, Vishakhapatnam, Kakinada, Thrissur, Coi 24 Sep, 2025

Dear Candidate, Greetings From APEX SERVICES Designation- Assistant manager/Deputy manager Role- Equity Dealer brokingcross salesshare marketsecuritiesclient acquisitionequity advisorequity dealer

District Manager
MNR Solutions Pvt Ltd Fresher Mysore, HosurHosur, Karnataka, Tamil Nadu, Gujarat, Chittorgarh, Rajasthan, Surat, Surendranagar, Er 24 Sep, 2025

Responsible for Sales and collection target achievement Expanding into new talukas Expanding franchisee network and increasing dealer share of wallet Ensuring marketing camp...
farmersdistrict sales managementchannel salesdealer sales

Sales Executive -Urgent Hiring
Planet Spark Fresher Madurai, AssamAssam, Bangalore, Arwal, Hyderabad, Vishakhapatnam, Karbi Anglong, Gurugram, Mumbai Ci 24 Sep, 2025

Job Location: Gurgaon (Full-time, On-site) Candidates must be willing to relocate.
communication skillsnegotiation skillsdomestic salessalesforceinternational salessales

Equity Dealer(South)
Apex Services Hiring For One of the leading broking firm Fresher Kakinada, GunturGuntur, Vishakhapatnam, Nellore, Vijayawada, Kochi, Kozhikode, Thrissur, Mysore, Coi 24 Sep, 2025

Dear Candidate, Greetings From APEX SERVICES Designation- Assistant manager/Deputy manager Role- Equity Dealer brokingcross salesshare marketsecuritiesclient acquisitionequity advisorequity dealer

Equity Dealer(South)
Apex Services Hiring For One of the leading broking firm Fresher Kakinada, GunturGuntur, Vishakhapatnam, Nellore, Vijayawada, Kochi, Kozhikode, Thrissur, Mysore, Coi 24 Sep, 2025

Dear Candidate, Greetings From APEX SERVICES Designation- Assistant manager/Deputy manager Role- Equity Dealer brokingcross salesshare marketsecuritiesclient acquisitionequity advisorequity dealer

Software Developer (Full Stack)
EY Fresher Kochi, Kerala 24 Sep, 2025

Role Overview: At EY, youll have the opportunity to build a unique career with global scale, support, inclusive culture, and technology to help you become the best version of yourself. Your unique...
SQLMicrosoft AzureAngularETL technologyMicrosoft Azure Data ServicesAzure Data FactoryDatabricksAzure Data Lake StoreDatabase conceptsData LakeWeb APIPowerBIPowerAppsPowerAutomatePMI

Restaurant Captain
ALTSEO PRIVATE LIMITED Fresher Kochi, AnantnagAnantnag, Bangalore, Jalore, Jabalpur, Moga, Kavaratti, Hassan, Coimbatore, Tuensang 24 Sep, 2025

Job description 1. Supervise the functions of the department employees, facilities smooth operations on a daily basis. 2. Ensures clean & safe work environment for team & Customers. 3. 80...
order takingrestaurant managementsafety complianceinventory controlmenu developmentoperationsleadership skillsoperations managementorder accuracy

Application Sales Jodhpur (IVD)
ACCUREX BIOMEDICAL PRIVATE LIMITED Fresher Jodhpur, Rajasthan 24 Sep, 2025

As an Application Sales Specialist at Accurex Biomedical in Jodhpur, you will be responsible for providing clinical application support and driving sales in the IVD domain. Your role will involve...
Application SupportSalesMarket IntelligenceDiagnostic InstrumentsCustomer Queries

Software Tester
Brightcode Software Services Fresher Ranchi, Jharkhand 24 Sep, 2025

As a Software Tester, you should possess a B.Tech (CS , IT) / BCA / MCA qualification and have 1 - 3 years of professional experience. Your responsibilities will include being strong in Database T...
Manual TestingDatabase testingSystem TestingBrowser TestingDefect ManagementAutomation Testing

Farmer Success Associate
Kheyti Fresher Gumla, Jharkhand 24 Sep, 2025

Role Overview: As a Farmer Success Associate at Kheyti, you will have the opportunity to work with smallholder farmers in India to help them battle climate change. Your main responsibilities will ...
AgricultureHorticultureAgronomy

Customer Relationship Officer
Talent Acquaintance Fresher Ranchi, GurugramGurugram, Gandhinagar, Jaipur, Jabalpur, Raipur, Vishakhapatnam, Delhi, Bhopal, Ahme 24 Sep, 2025

Immediate Openings BPO International Process (Voice, Chat & Email) Location: Jaipur Sitapura, Mans...
international voice processcustomer servicecommunication skillscustomer supportvoice processquery resolutioncustomer interactionnon voice process

Travel Consultant (GDS)
Elevate X solutions Fresher Jaipur 24 Sep, 2025

job title: travel consultant (gds) location: jaipur, india experience required: minimum 2 years (amadeus gds mandatory) education: graduate / undergraduate working days: 5.5 days per week shift t...
international call centertravel desktravel managementinternational bpo

Customer Relationship Officer
Talent Acquaintance Fresher Jaipur, DelhiDelhi, Gandhinagar, Jabalpur, Raipur, Gurugram, Vishakhapatnam, Ranchi, Bhopal, Ahmedab 24 Sep, 2025

Immediate Openings BPO International Process (Voice, Chat & Email) Location: Jaipur Sitapura, Mans...
international voice processcustomer servicecommunication skillscustomer supportvoice processquery resolutioncustomer interactionnon voice process

Field Sales Executive ( Relationship Manager)
SAPIENCE STAFFING & SERVICES PVT LTD Fresher Jaipur, DelhiDelhi, Ghaziabad, Gurugram 24 Sep, 2025

Position Overview We are seeking a dynamic and results-driven Field Sales Executive (Relationship Manager) to join our team. This role is pivotal in driving our business grow...
business loansecured financingbusiness loansmortgage loanmortgage loanslaphousing loanhousing finance

Lead - Post Sales
Livspace Fresher Jaipur, Rajasthan 24 Sep, 2025

Role Overview: As a Lead-Post Sales at Livspace, your primary responsibility is to handle customer complaints and reconcile them according to Livspaces warranty policy. Your role plays a crucial p...
ModularHardwarePresentation SkillsInterpersonal SkillsAnalytical SkillsCustomer SatisfactionInterior ProductsCustomTechnical ExpertiseInstallation ProcessMaterials SpecificationsVerbal ArticulationWritten Communication SkillsProblemSolving Sk

.NET MVC Developer
Markstein Technology Solutions Fresher Gwalior, Madhya Pradesh 24 Sep, 2025

As an ASP.NET MVC developer at Markstein, you will have the opportunity to develop and support existing applications using optimal technologies and patterns. Your responsibilities will include des...
MS SQL ServerEntity FrameworkAngularJSJavascriptjQueryHTMLCSSSQL ServerOOPSAjaxWeb ServicesLinqNET MVCASPNET With CWeb API

Specialist I - SE - React , Typescript
UST Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

Role Overview: As a Lead Software Engineer within our enterprise product domain, you will play a pivotal role as both an expert individual contributor and a technical multiplier. You will be respo...
JavascriptReactJsNodeJs

Technical lead
Kalki Communication Technologies Fresher Kochi, Kerala 24 Sep, 2025

As a Technical Lead - Manual Testing, you will be responsible for leading a team of 4-6 members, preparing test plans, and developing test cases based on RTM. Your knowledge on IEC protocols, Linu...
Manual testingLinuxOracleSQL ServerMySQLTomcatJBossJIRABugzillaConfiguration ManagementWeb application testingIEC protocols

Senior Java/Fullstack Developer / Database Architect- KERLA
PRIMATE CONSULTING SERVICES PRIVATE LIMITED Fresher Ernakulam 24 Sep, 2025

Senior Java/Fullstack Developer / Technical Solution & Database Architect Job Summary We are seeking a highly experienced and technically sound Senior Java Developer who can take ownership as a...
javadatabase architecture

Software Developer (.Net)
BlueSeven Technologies LLC Fresher Kochi, Kerala 24 Sep, 2025

BlueSeven Technologies LLC, a Dubai based company owned by ATS Travel, a leading Travel Management Company with over 40 years of experience in providing comprehensive travel solutions to corporate...
NETSQL ServerWCFAngularJSJavaScriptjQueryOOPsMicrosoft SQL ServerGitASPNet MVCASPNet CoreWeb API

PREV
NEXT

sql server queries Job Openings

Position Overview We are seeking a dynamic and results-driven Field Sales Executive (Relationship Manager) to join our team. This role is pivotal in driving our business grow... business loansecured financingbusiness loansmortgage loanmortgage loanslaphousing loanhousing finance

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Position Overview We are seeking a dynamic and results-driven Field Sales Executive (Relationship Manager) to join our team. This role is pivotal in driving our business grow...
business loansecured financingbusiness loansmortgage loanmortgage loanslaphousing loanhousing finance