surround sound jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

surround sound Job Openings

Showing 4451 - 4500 of 4813 Jobs

Data Entry Operator l Work from Home l Part time

Fondstaff Private Limited 0.00 to 3.00 Years Hyderabad 12 Oct, 2023

data conversion

data entry

part time

work from home typing

AWS/ Amazon Web Services Developer

Infosys Limited 2.00 to 5.00 Years Hyderabad 12 Oct, 2023

project life cycle

software quality assurance

Integrated Security Risk Management Security Architect

Accenture 8.00 to 10.00 Years Gurugram 12 Oct, 2023

About Accenture:

disaster recovery planning

business continuity planning

information systems management

Senior Data Scientist

Nustar Technologies India Private Limited Hiring For Nustar Technologies India Private Limited 5.00 to 10.00 Years Gurugram 12 Oct, 2023

Job Purpose and primary objectives: To manage a team ofdataanalysts/scientists for the delivery of insights for several...
machine learningpythonnumpy

Bancassurance & Direct Marketing Opening with Leading Life Insurance Company.
RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 1.00 to 6.00 Years Gurugram 12 Oct, 2023

Dear Candidate This is regarding MNC based Life Insurance openings for *BANCASSURANCE*, *DIRECT* ,*AGENCY* & *TELE* channel in *Mumbai-All Region*. Location : Mumbai-All Region/Bangalore/Hydera...
developmentunitinsurancehealthsrmbdmmanager

Performance Marketing Executive | E-Store For Apparels & Handicrafts
Unnati 1.00 to 5.00 Years Delhi 12 Oct, 2023

Our client is a 5-year-old online platform where one can buy exclusive range of handcrafted clothing and accessories, home decor and more. Their textiles and designs range from Patola, Kalamkari...
ppcgoogle adwords

Bancassurance & Direct Marketing Opening with Leading Life Insurance Company.
RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 1.00 to 6.00 Years Delhi 12 Oct, 2023

Dear Candidate This is regarding MNC based Life Insurance openings for *BANCASSURANCE*, *DIRECT* ,*AGENCY* & *TELE* channel in *Mumbai-All Region*. Location : Mumbai-All Region/Bangalore/Hydera...
developmentunitinsurancehealthsrmbdmmanager

Customer Care Executive - Females
IMF Consultants 2.00 to 4.00 Years Chennai 12 Oct, 2023

Customer Care Executive - Females Location: Chennai Experience: 2 to 4 years Education: Diploma/ITI Industry: Automobile / Auto Ancillaries Roles and responsibilities for Customer support exe...
customer supportcustomer service skillscustomer care

Heavy Construction Manager
AWINMO INDIA MARKETING PRIVATE LIMITED 9.00 to 14.00 Years Chennai 12 Oct, 2023

Heavy Equipment Operator Job Description Template We are searching for a skilled heavy equipment operator to utilize our industrial gear....
negotiation skillsriskcommunication skillsorganizationleadership skillsexecutive managementfinancemanagementfinancialcritical

Bancassurance & Direct Marketing Opening with Leading Life Insurance Company.
RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 1.00 to 6.00 Years Chennai 12 Oct, 2023

Dear Candidate This is regarding MNC based Life Insurance openings for *BANCASSURANCE*, *DIRECT* ,*AGENCY* & *TELE* channel in *Mumbai-All Region*. Location : Mumbai-All Region/Bangalore/Hydera...
developmentunitinsurancehealthsrmbdmmanager

Part -Full Time / Online Data Entry / Home-Based
Fondstaff Private Limited 0.00 to 3.00 Years Bangalore 12 Oct, 2023

Laptop/Desktop is required. Training will beprovided No Target work. Desired skills and qualities: Fresher and experience both can apply. 12th pass or any Graduate can apply. Basic Computer Know...
data entryonline data entrydata conversionwork from home typingservicebackendback office

Manufacturing Domain Consultant - Scrum Master
Infosys Limited 0.00 to 2.00 Years Bangalore 12 Oct, 2023

The Process lead position is responsible for the proper process execution of the development for a designated part of the product portfolio roadmap. The process lead would review current Waters pr...
deliveryreportingaccountinganalyticsautomationproduct life cyclelife science industryiso 9001iso 13485life cyclescrum masterprogram managersproduct portfolioprocess excellenceinterpersonal skillsisoniceagilescrum

Heavy Construction Manager
AWINMO INDIA MARKETING PRIVATE LIMITED 9.00 to 14.00 Years Bangalore 12 Oct, 2023

Heavy Equipment Operator Job Description Template We are searching for a skilled heavy equipment operator to utilize our industrial gear....
negotiation skillsriskcommunication skillsorganizationleadership skillsexecutive managementfinancemanagementfinancialcritical

HIRING FOR MAXIMO- APPLICATION DEVELOPER
Inspiration Manpower Consultancy Private Ltd 5.00 to 8.00 Years Bangalore 12 Oct, 2023

Job description Job Key Responsibilities : -Having 6-8 years of experience in Maximo java customization -Technical/Functional expertise on more than one of Industry Specific...
application developmentapplication programming

Hire for _Ios Development
GFL RECRUITMENT PRIVATE LIMITED 1.00 to 2.00 Years Ahmedabad 12 Oct, 2023

Job Description
EXPERIENCE :- 2 years QUALIFICATION :-B.E.(I.T.) / B.E.(C.S.) / MCA / M.Sc. (I.T.) DESCRIPTION Perception ne...
iosdesignios development

Automation Test Engineer - Executive
GFL RECRUITMENT PRIVATE LIMITED 1.00 to 5.00 Years Ahmedabad 12 Oct, 2023

Job Description
Max. Notice period: 30 days Experience: 1-3 years

Designing and developing test automation scripts using testing automation guidelines.

Researchin...
seleniumunit testing

Senior Manager for Industrial Refrigerator Industry
Launching Careers 9.00 to 14.00 Years Pune 10 Oct, 2023

Designation We are hiring for Senior Manager role for industrial refrigeration company. Role Description

Overseeing the team of Sales, Project & Des...
cold storagechillersaircoolersrefrigerationammonia refrigerationfreezershvac

Bancassurance & Direct Marketing Opening with Leading Life Insurance Company.
RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 1.00 to 6.00 Years Pune 10 Oct, 2023

Dear Candidate This is regarding MNC based Life Insurance openings for *BANCASSURANCE*, *DIRECT* ,*AGENCY* & *TELE* channel in *Mumbai-All Region*. Location : Mumbai-All Region/Bangalore/Hydera...
developmentunitinsurancehealthsrmbdmmanager

Deputy General Manager(L4) -SMTL HMI & Audio
Tata Motors Ltd 10.00 to 12.00 Years Pune 10 Oct, 2023

Position Summary with Job Responsibilities Job Description Job Title: SMTL Infotainment - Audio Expert Business Unit: ERC - PVBU Function: Electrical & Electronics Locatio...
salesmarketingbusiness developmentmanagementbudgetingaudio system designcontinuous improvement facilitationsystem designsurround soundinspiring teamsmusic productionmeasurement toolsnoise cancellationalgorithm developmentcommunication protoc

Technology Lead - Java (5-8 years) - Nagpur
Infosys Limited 2.00 to 5.00 Years Nagpur 10 Oct, 2023

A day in the life of an Infoscion As part of the Infosys delivery team, your primary role would be to interface with the client for quality assurance, issue resolution and ensuring high customer s...
javasql serversqlcustomer relationsenvironmentproject life cyclesoftware quality assurancelife cycletesting toolsproblem solvingtechnical skillssoftware qualityissue resolutionquality assurancesolution deliveryquality processesproject esti

Data Solutions - ESG Analytics and Portfolio Insights Associate
JPMorgan 10.00 to 12.00 Years Mumbai City 10 Oct, 2023

Team Background The ESG Analytics and Portfolio Insights team is a part of the Data Solutions organization within the Corporate and Investment Bank (CIB)s Securities Services ...
key performance indicatorsmarket datadue diligencemiddle officedata solutionscustom reportsproblem solvingclient reportingfinancial marketscritical thinkingscenario analysisproduct developmentbusiness requirementsfinancial justificationclien

Vacant Territory Manager & Territory Officer
Adidev Herbals Pvt Ltd 2.00 to 5.00 Years Hyderabad 10 Oct, 2023

Required Area Sales Managers /Sales managers/ABM/RSM/SSOto market Herbal, Beauty & Personal care, hair care, skin care. OTC & some pharma products/Health care products, Ayurvedic products through...
cosmeticsbeauty industrysecondary salesfmcg marketingfmcg channel salesmarketingskin care productsanti-aging productssales

Bancassurance & Direct Marketing Opening with Leading Life Insurance Company.
RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 1.00 to 6.00 Years Hyderabad 10 Oct, 2023

Dear Candidate This is regarding MNC based Life Insurance openings for *BANCASSURANCE*, *DIRECT* ,*AGENCY* & *TELE* channel in *Mumbai-All Region*. Location : Mumbai-All Region/Bangalore/Hydera...
developmentunitinsurancehealthsrmbdmmanager

Customer Support Executive
Sharda IT Services 2.00 to 3.00 Years Gurugram 10 Oct, 2023

JOB Summary: We are seeking a motivated and experienced Customer support Executive to join our team. The ideal candidate will have a minimum of 2-3 years of experience in the travel industry, pr...
amadeusgdssabre reservation systemgalileo

Technical Manager-Gold Loans
HDFC Bank Ltd 4.00 to 9.00 Years Delhi 10 Oct, 2023

The Gold Loan business has collateral risk, Assayer Risk and requires good customer selection. The key job responsibilities would be as follows Implementing of the defined policy Underwriting of ...
change processcredit bureaudata management

Java Technology Lead
Infosys Limited 2.00 to 8.00 Years Gurugram 10 Oct, 2023

Hiring Across Gurgaon, Bangalore, Pune & Mumbai A day in the life of an Infoscion As part of the Infosys delivery team, your primary role would be to interface with the client for quality assuranc...
javasql serversqlcustomer relationsenvironmentproject life cyclesoftware quality assurancelife cycletesting toolsproblem solvingtechnical skillssoftware qualityissue resolutionquality assurancesolution deliveryquality processesproject esti

Java Springboot Microservices Developer (Mid-Level/Lead)
Infosys Limited 2.00 to 5.00 Years Bangalore 10 Oct, 2023

A day in the life of an Infoscion As part of the Infosys delivery team, your primary role would be to interface with the client for quality assurance, issue resolution and ensuring high customer s...
project life cyclesoftware quality assurancelife cycletesting toolsproblem solvingtechnical skillssoftware qualityissue resolutionquality assurancesolution deliveryquality processesproject estimationagile methodologiesknowledge managementcom

MDM (Informatica, Reltio, IBM, STIBO, PIM/ P360/ IDQ/ S360/Semarchy)
Infosys Limited 0.00 to 8.00 Years Bangalore 10 Oct, 2023

A day in the life of an Infoscion As part of the Infosys delivery team, your primary role would be to interface with the client for quality assurance, issue resolution and ensuring high customer s...
project life cyclesoftware quality assurancelife cycletesting toolsproblem solvingtechnical skillssoftware qualityissue resolutionquality assurancesolution deliveryquality processesproject estimationagile methodologiesknowledge managementcom

Mainframe Lead
Infosys Limited 2.00 to 6.00 Years Bangalore 10 Oct, 2023

We are looking for a Mainframe lead responsible for diagnosing problem areas, designing innovative solutions, facilitating deployment and defining and automating the processes. As part of the Info...
project life cyclesoftware quality assurancelife cycleibm rationaltesting toolsproblem solvingtechnical skillssoftware qualityissue resolutionquality assurancesolution deliveryquality processesproject estimationagile methodologiesknowledge m

Trade Sales Manager(For Leading Pvt Bank)
Acura Solutions 7.00 to 8.00 Years Ahmedabad 10 Oct, 2023

Trade Sales Manager(For Leading Pvt Bank)

A Team Leader, who will handle a Team of Trade Relationship M...
salestrade relationship mangers

Operations Executive,manager
Axycube Solutions Pvt Ltd 2.00 to 7.00 Years Mumbai City 04 Oct, 2023

Hi , Greetings from Axycube Solutions Pvt. Ltd. We are looking for Operations Manager for one of our Client. The details are given below. Location: Mumbai- vashi Work...
project managementcrm

BPO T&S Operations Analyst
NTT Global Delivery Services Limited 1.00 to 3.00 Years Gurugram 04 Oct, 2023

The Company NTT DATA Services is a top 10 global services company and part of the NTT Group, a Fortune 29 telecommunications and services company based in Japan. We operate with 60,000 professio...
customer relationsreportingmisslaaccountsbusiness process outsourcingcash flowfixed incomedue diligencedata servicesprivate equityglobal servicescapital marketsbusiness processwealth managementclient engagementmanagement systemfinancial p

Information Security Specialist
Nokia Solutions and Networks India Pvt Ltd 6.00 to 10.00 Years Noida 04 Oct, 2023

The Customer Experience organization provides a common interface to customers including account and relationship management, acting as the voice of the customer internally and creating ...
networkinglinuxinformation securitytroubleshooting

Safety Supervisor & Safety Officer
Seas Safeline Engineers 1.00 to 3.00 Years Delhi 04 Oct, 2023

Job Details

Required Experience: 1-3 Yrs

Qualification: Any Technical Qualification with Safety Course

Location: Pune, Delhi, Udupi,

Sala...
safety engineeringsafety auditingsafety officer activitiesconstruction safetysafetysafety management systemfire safety

Trademark Associate Attorney-Bangalore
Space Consultant 3.00 to 5.00 Years Bangalore 04 Oct, 2023

Title: Trademark Associate Nature of Job: Full time Location: Bangalore Reports To: Concerned Partners Years of experience: 3-4 years Eligible candidates contact us at hid...
trademark lawdrafting

secretary patent
Space Consultant 1.00 to 3.00 Years Bangalore 04 Oct, 2023

Urgent Requirement Profile: Secretary in Patent Department Location: Bangalore Exposure and experience in the e-filing module of the Indian Patent office Desired Skills and Experience: - ...
patentsipr lawse-filing

Calibration Engineer AirSystem_Pune
Bosch Group 5.00 to 7.00 Years Pune 03 Oct, 2023

Job Description BE, M.Tech (Mechanical, Automobile). 5-7 years of relevant work experience. Experienced in technically leading / working on calibration development projects Experience in calib...
calibrationmechanicalisonabldocumentationengine management systemsmanagement systemsprofessional mannerpidincaetassoundtestingcontrolclimatebusinessmanagementcomponentspowertrain

Applications invited for General Manager / Chief Engineer (Electrical) at APMD
Amity University 5.00 to 14.00 Years Noida 03 Oct, 2023

Applications invited for General Manager / Chief Engineer (Electrical) at APMD - 12-10-2022 - Adv/AUUP/HR/21/093 Advertisement Date: 12-10-2022 Adv/AUUP/HR/21/093 AMITY UNIVERSITY We at Amity Powe...
mechanicalsafetymachineryhvacplumbingair conditioningpower managementcommunication skillsverbal communicationelectrical engineeringpansolarsoundresumeengineersmanagement

Hiring For System Engineer
HARJAI COMPUTERS PRIVATE LIMITED 4.00 to 6.00 Years Mumbai City 03 Oct, 2023

Location Vashi office Experience 4 to 6 years MAJOR ROLES AND RESPONSIBILITIES Installing configuring operating systems and other software and routinely test installed software for glitch detec...
system engineeringconfiguration

Technical Solution Architect, Webex Customer Experience (Contact Center & CPaaS) India
Cisco Systems, Inc 4.00 to 6.00 Years Mumbai City 03 Oct, 2023

What You ll Do As a Webex Customer Experience Technical Solutions Architect (TSA), your primary responsibility is to provide technical guidance and presales engineering support for Customer Expe...
accountsnegotiationstoragecapacity planningconsultingpop culturetrade showscustomer carecontact centertechnical salessolution designcustomer experienceengineering supportbusiness developmentrequirements gatheringcalendar managementrestful

It Desktop Engineer
Intouch CX 2.00 to 5.00 Years Hyderabad 03 Oct, 2023

Job description About the Job Were looking for an IT Desktop Generalist to maintain and repair computers, hardware, and software in a break/fix environment. The ideal candid...
software engineeringdesktop engineering

Sales Development Representative
RyTe4U Consultants 1.00 to 5.00 Years Hyderabad 03 Oct, 2023

Job Summary Want to kick off an exciting career with a fast-growing cloud technology business We are looking for highly energetic, customer-centric, driven professionals with s...
sales managementprocessvoicesales coordinationinternationalsales administration

Planning Engineering
AVHAD ENTERPRISES 7.00 to 12.00 Years Hyderabad 03 Oct, 2023

We are searching for a well-organized self-starter with great attention to detail to join our team as the new planning engineer. Day-to-day responsibilities include drawing up work schedules and ...
engineering changeengineering documentationplanning engineeringmechanical engineeringenvironmental engineeringengineering change controlengineering consultancyengineering change management

Transaction Risk Monitoring Gurugram
Inspiration Manpower Consultancy Private Ltd 8.00 to 13.00 Years Gurugram 03 Oct, 2023

Job description Greetings! Huge openings forTransaction Monitoringfor candidates with below skills set. Skills Set:

Anti-Money La...
transaction managementrisk management

Producers and Directors
Krishna Consultancy Hiring For Production company 13.00 to 22.00 Years Bangalore 03 Oct, 2023

create project budgets, and hire the right director. The producer is also responsible for finding new projects to make into a TV show or movie, and acquire the rights to the script. To be succes...
creativitysound designeditingproject managementleadershipcommunication skillsproblem solving

Python Lead
Infosys Limited 2.00 to 6.00 Years Pune 02 Oct, 2023

A day in the life of an Infoscion As part of the Infosys delivery team, your primary role would be to interface with the client for quality assurance, issue resolution and ensuring high customer s...
project life cyclesoftware quality assurancelife cycletesting toolsproblem solvingtechnical skillssoftware qualityissue resolutionquality assurancesolution deliveryquality processesproject estimationagile methodologiesknowledge managementcom

Angular Lead
Infosys Limited 2.00 to 5.00 Years Pune 02 Oct, 2023

A day in the life of an Infoscion As part of the Infosys delivery team, your primary role would be to interface with the client for quality assurance, issue resolution and ensuring high customer s...
project life cyclesoftware quality assurancelife cycletesting toolsproblem solvingtechnical skillssoftware qualityissue resolutionquality assurancesolution deliveryquality processesproject estimationagile methodologiesknowledge managementcom

.Net Core Senior Developer
Infosys Limited 0.00 to 2.00 Years Pune 02 Oct, 2023

A day in the life of an Infoscion As part of the Infosys delivery team, your primary role would be to interface with the client for quality assurance, issue resolution and ensuring high customer s...
javajquerysql serversqlenvironmentproject life cyclesoftware quality assurancelife cycletesting toolsproblem solvingtechnical skillssoftware qualityissue resolutionquality assurancesolution deliveryquality processesproject estimationagile

.Net Lead
Infosys Limited 2.00 to 5.00 Years Nagpur 02 Oct, 2023

We are looking for a .Net technical lead responsible for building .Net applications and leading development teams. Will have to leverage his or her knowledge and skills with .Net technologies and ...
project life cycleteam leading skillssoftware quality assurancesql serverlife cyclesql queriesteam leadingtesting toolsteam handlingproblem solvingdesign patternsversion controlentity frameworktechnical skillssoftware qualityquality assuran

Medical Billing Vacancy
AKSHITA INTERPRISES 0.00 to 4.00 Years Mangalore 02 Oct, 2023

We are seeking a qualified and dedicated medical biller to join our administrative office. In this position, you will be responsible for a variety of tasks requiring data analysis, in-depth evalu...
medical terminologymedical recordsmedical billinghealthcare

PREV
NEXT

surround sound Job Openings

Heavy Equipment Operator Job Description Template We are searching for a skilled heavy equipment operator to utilize our industrial gear.... negotiation skillsriskcommunication skillsorganizationleadership skillsexecutive managementfinancemanagementfinancialcritical

Heavy Equipment Operator Job Description Template We are searching for a skilled heavy equipment operator to utilize our industrial gear.... negotiation skillsriskcommunication skillsorganizationleadership skillsexecutive managementfinancemanagementfinancialcritical

Job description Job Key Responsibilities : -Having 6-8 years of experience in Maximo java customization -Technical/Functional expertise on more than one of Industry Specific... application developmentapplication programming

Job Description

Job Description

Job description About the Job Were looking for an IT Desktop Generalist to maintain and repair computers, hardware, and software in a break/fix environment. The ideal candid... software engineeringdesktop engineering

Job description Greetings! Huge openings forTransaction Monitoringfor candidates with below skills set. Skills Set: Anti-Money La... transaction managementrisk management

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Heavy Equipment Operator Job Description Template We are searching for a skilled heavy equipment operator to utilize our industrial gear....
negotiation skillsriskcommunication skillsorganizationleadership skillsexecutive managementfinancemanagementfinancialcritical

Heavy Equipment Operator Job Description Template We are searching for a skilled heavy equipment operator to utilize our industrial gear....
negotiation skillsriskcommunication skillsorganizationleadership skillsexecutive managementfinancemanagementfinancialcritical

Job description Job Key Responsibilities : -Having 6-8 years of experience in Maximo java customization -Technical/Functional expertise on more than one of Industry Specific...
application developmentapplication programming

Job description About the Job Were looking for an IT Desktop Generalist to maintain and repair computers, hardware, and software in a break/fix environment. The ideal candid...
software engineeringdesktop engineering

Job description Greetings! Huge openings forTransaction Monitoringfor candidates with below skills set. Skills Set:

Anti-Money La...
transaction managementrisk management