aws cloud stack jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

aws cloud stack Job Openings

Showing 4101 - 4150 of 14824 Jobs

Laravel Developer

Param Software Fresher Rajkot, Gujarat 24 Sep, 2025

Microservices Architecture

Laravel Livewire

Inertiajs

Tech Lead

Sterlite Technologies Limited Fresher Bhadrak 24 Sep, 2025

Functional specifications

Cost Center Accounting CCA

Profit Center Accounting PCA

Profitability Analysis CO

.NET Developer

FinJo Fresher Khordha 24 Sep, 2025

NET CoreNET Framework

ASPNET MVC

Web API

Entity FrameworkEF Core

RESTful services

presales consultant

BSH TECHNOLOGIES PRIVATE LIMITED Fresher Bhubaneswar 24 Sep, 2025

Work closely with the Business Development & Sales teams to support lead qualification and opportunity conversion.
Conduct r...
crmpresentationsclientsmbsoftwaresalestoolsexcelpowerpointdemosmarketproposalsstrongmandatory.knowledgesystems.serviceslikeestimationsusing

Data Science Trainee / Junior Data Scientist

Bloom Infotech Fresher Punjab 24 Sep, 2025

Magento 2 Developer

Sookshum Labs Technologies Private Limited Fresher Punjab 24 Sep, 2025

Magento Best Practices

Relational Database Systems

ObjectOriented Programming

ProblemSolving

Organizational Skills

GIT Version Control

Senior Front End Developer .NET

Milestone Technologies, Inc Fresher Kochi, Kerala 24 Sep, 2025

WebSocket integration

Webpack

Vite

CICD pipelines

Software Developer (Full Stack)

EY Fresher Kochi, Kerala 24 Sep, 2025

Microsoft Azure Data Services

Azure Data Factory

Databricks

Azure Data Lake Store

Executive Chef

Tiffin Box Ranchi Fresher Ranchi, Jharkhand 24 Sep, 2025

Internship Trainee(Live project trainee 3 to 6 month 8 hours per day get exp

Guidance Placement Hiring For - Fresher Jaipur, NoidaNoida, Delhi, Gwalior, Kanpur, Gurugram, Bhopal, Agra, Patna 24 Sep, 2025

hidden_mobile

Backe by DesignDgo Python Expert Senior Level

Inspire-I Solution Fresher Ahmedabad, Gujarat 24 Sep, 2025

Senior Java Developer

Delta Sys-Tech (India) Pvt Ltd Fresher Ahmedabad 24 Sep, 2025

Permanent job opening for Java Fullstack Developer with US MNC organization at Ahmedabad

Job Description

Years of experience 6 9 / 9 - 12 years spring bootjavastackangularjshibernatemicroservicescore javareact.jsdeveloper

Specialist I - SE - React , Typescript
UST Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

Role Overview: As a Lead Software Engineer within our enterprise product domain, you will play a pivotal role as both an expert individual contributor and a technical multiplier. You will be respo...
JavascriptReactJsNodeJs

Lead Data Scientist
Reflections Info Systems Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

As an experienced Lead Data Scientist with a minimum of 8 years of professional experience, including at least 6 years in a data science role, your expertise lies in statistical modeling, machine ...
Statistical ModelingMachine LearningDeep LearningPythonData VisualizationCommunication SkillsComputer VisionPredictive AnalyticsNatural Language ProcessingTime Series AnalysisAPIsAnomaly DetectionGenAIOptimizing CodeData PreprocessingFeatur

Fullstack Developer
PRIMATE CONSULTING SERVICES PRIVATE LIMITED Fresher Kochi 24 Sep, 2025

Required Skills & Qualifications 8 to 12 years of experience in software development with strong Java, Spring Boot expertise. Proven experience in designing microservices and distributed system...
javadeveloperspringboot

Senior Java/Fullstack Developer / Database Architect- KERLA
PRIMATE CONSULTING SERVICES PRIVATE LIMITED Fresher Ernakulam 24 Sep, 2025

Senior Java/Fullstack Developer / Technical Solution & Database Architect Job Summary We are seeking a highly experienced and technically sound Senior Java Developer who can take ownership as a...
javadatabase architecture

Software Developer (.Net)
BlueSeven Technologies LLC Fresher Kochi, Kerala 24 Sep, 2025

BlueSeven Technologies LLC, a Dubai based company owned by ATS Travel, a leading Travel Management Company with over 40 years of experience in providing comprehensive travel solutions to corporate...
NETSQL ServerWCFAngularJSJavaScriptjQueryOOPsMicrosoft SQL ServerGitASPNet MVCASPNet CoreWeb API

Research and Development Product Manager
First Screen Fresher Kochi, Kerala 24 Sep, 2025

As a Research and Development Product Manager at our company, you will play a crucial role in establishing and leading a new Research & Development unit. You will be responsible for bridging the g...
Team LeadershipProduct DevelopmentStakeholder ManagementAgile MethodologiesLeadershipProduct OwnershipSoftware Development ProcessesCloud TechnologiesEnglish CommunicationProblemSolving

Workday Finance Techno-functional Consultant Senior
Butterfly Groups Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

Role Overview: As a Workday Finance Techno-functional Consultant at our company, you will play a crucial role in leading or supporting Workday Financials implementations and post-go-live activitie...
Web ServicesSOAPRESTXMLXSLTJSONMatrixBIRTWorkday StudioEIBCore ConnectorsWorkday Prism AnalyticsAccounting CenterWorkday SecurityBusiness Process ConfigurationWorkday ReportingCompositeAdvancedDiscovery BoardsCalculated Fields

Full stack Developer- Angular
SE Mentor Solutions Fresher Kochi, Kerala 24 Sep, 2025

As a Frontend Developer with expertise in Angular and API development, you will be responsible for the following: - Creating reusable components, custom directives, decorators, and services to in...
AngularAPI developmentdesign patternsJavaScriptHTMLCSSAzureHealthcareBootstrapAzure DevOpsGitlabJenkinsRoutingPipesLINQNGRXTypeScriptFront EndUIAzure AppsIonicMaterial UITyped FormsPromise vs ObservablesRxJs OperatorsTask vs Thre

Site Reliability Developer 4
Oracle Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

The Network Reliability Engineering (NRE) team at Oracle Cloud is responsible for ensuring the robustness of the Oracle Cloud Network Infrastructure. As a Network Reliability Engineer, your primar...
Network EngineeringMPLSBGPIPv6DNSDHCPSSLData Center designPythonScriptingAutomationNetwork monitoringNETCONFVxLANEVPNTelemetry solutionsYANG

Python / Gen AI Developer
LION AND ELEPHANTS CONSULTANCY PRIVATE LIMITED Fresher Erode, CoimbatoreCoimbatore, Chennai, Tambaram, Pudukottai, Dindigul, Namakkal, Kumbakonam, Bangalor 24 Sep, 2025

Job Overview: We are looking for an experienced and passionate Python/Gen AI Developer to join our team in Coimbatore. The ideal candidate will have strong expe...
pythoncloud awsartificial intelligencedjangoflaskllmsgenerative ailanggraphpyspark

Fresher Internship Trainee(Live project trainee)
Guidance Placement Hiring For - Fresher Patna, GurugramGurugram, Jaipur, Gwalior, Noida, Kanpur, Delhi, Bhopal, Agra 24 Sep, 2025

Dear Candidate, We are excited to announce urgent openings for both freshers and experienced professionals in various fields. If you are interested in a live project trainee or internship opport...
react.jsandroidphpweb designingangular jslaravelweb developersoftware developersfull stack developer

Workday HCM Consultant
BISP Solutions Fresher Bhopal, Madhya Pradesh 24 Sep, 2025

Role Overview: You will be responsible for providing Workday HCM consulting services at our Bhopal office. Your primary focus will be on Workday Recruiting, including implementation support rollou...
Business ProcessSDLCTeam LeadershipCompensationSecurityWorkday RecruitingAgile project methodologiesWorkday HCMOrg Structures

Fresher Internship Trainee(Live project trainee)
Guidance Placement Hiring For - Fresher Bhopal, GwaliorGwalior, Jaipur, Noida, Kanpur, Gurugram, Delhi, Agra, Patna 24 Sep, 2025

Dear Candidate, We are excited to announce urgent openings for both freshers and experienced professionals in various fields. If you are interested in a live project trainee or internship opport...
react.jsandroidphpweb designingangular jslaravelweb developersoftware developersfull stack developer

Spring Boot Developer with AWS for Bangalore, Hyderabad and Pune
WHITE HORSE MANPOWER CONSULTANCY (P) LTD Fresher Pune, BangaloreBangalore, Hyderabad 23 Sep, 2025

We are hiring experienced Spring Boot Developers with AWS experti...
microservicesrest apiawskubernetesdockeraws lambdaaws rdsaws ec2cloud deployment

Network Engineer - NAC or TAC
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Pune, BangaloreBangalore, Chennai, Noida, Hyderabad, Gurugram, Kolkata, Mumbai City, Delhi 23 Sep, 2025

Position: Network Engineer - NAC or TAC Pre-requisite - Candidate should be well versed with Networking concepts and he should have at least 4 to 5 years of experience. Keyword...
tacroutingnacswitchingengineer

SAP DRC Consultant
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Pune, BangaloreBangalore, Mumbai City 23 Sep, 2025

Job Title: SAP DRC Consultant
Location: Mumbai, Pune and Banglore Experience: 414yrs Job Type: Full-t...
drccompliancesaphubdocument

Senior Software Developer - React JS
Zehn Solutions Fresher Nagpur, Maharashtra 23 Sep, 2025

Zehn Solutions is searching for enthusiastic, passionate, and self-motivated individuals to join our team of dedicated professionals. We are committed to personal and organizational growth. If yo...
Java ScriptCSS3jQueryBootstrapCore JavaScriptObjectoriented programmingCall stackES6Page load timeUI performance enhancementCross network API consumptionAuthorization tokensReact JSReact NativeRedux

Mlops Engineer
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Noida, DelhiDelhi, Bangalore, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City 23 Sep, 2025

Location- PAN India Grade- C1 to C2 Exp- 6 to 12 Years Key Responsibilities: 1. Design, implement, and maintain end-to-end ML pipelines for model training, evaluation, and deployment 2. Collabor...
machine learningdockerpythonpipelinedevopskubernetesmlopstensorflowpytorchci/cd

Oracle SCM - Associate 2
PwC Acceleration Center India Fresher Hyderabad, Telangana 23 Sep, 2025

A career in our Advisory Acceleration Centre is the natural extension of PwCs leading class global delivery capabilities. We provide premium, cost-effective, high-quality services that support pro...
InventoryProcurementMaintenanceSCORImplementing Planning CentralCosting modulesOracle CloudSupply Chain Business Processes

Risk Consulting Analyst 2 - Managed Security
RSM US LLP Fresher Hyderabad, Telangana 23 Sep, 2025

You will be joining RSM, a leading provider of professional services to the middle market globally, with a focus on instilling confidence in a world of change and enabling clients and employees to...
IT operationsSecurity monitoringActive directoryIP networkingAutomationServiceNowNetFlowThreat intelligenceMalware analysisCybersecurityCloud technologiesSIEM toolsStellar CyberHyas InsightDNS ProtectSentinel OneELK StackVirus totalShoda

Mlops Engineer
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Gurugram, DelhiDelhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 23 Sep, 2025

Location- PAN India Grade- C1 to C2 Exp- 6 to 12 Years Key Responsibilities: 1. Design, implement, and maintain end-to-end ML pipelines for model training, evaluation, and deployment 2. Collabor...
machine learningdockerpythonpipelinedevopskubernetesmlopstensorflowpytorchci/cd

Mlops Engineer
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Delhi, NoidaNoida, Bangalore, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City 23 Sep, 2025

Location- PAN India Grade- C1 to C2 Exp- 6 to 12 Years Key Responsibilities: 1. Design, implement, and maintain end-to-end ML pipelines for model training, evaluation, and deployment 2. Collabor...
machine learningdockerpythonpipelinedevopskubernetesmlopstensorflowpytorchci/cd

Java Backend developer
MNR Solutions Pvt Ltd Fresher Noida, BangaloreBangalore, Mumbai City 23 Sep, 2025

Dear Candidates, Currently looking for a Java Backend developer hiring for a Singapore based MNC On direct payroll Exp-5years NP-Immediate to 25th Aug before location-Noida, Mumbai Bangalore 5 ...
gcpapimicroservicesno sql

Software Development Engineer - 2 (NextJS UI Developer)
RateGain Fresher Noida, Uttar Pradesh 23 Sep, 2025

As a highly skilled and experienced Full Stack Developer with expertise in Next.js and .NET, you will be joining our engineering team to design, develop, and deploy scalable applications. Your rol...
JavaScriptNETLINQTypeScriptReactNextjsASPNET CoreEntity Framework CoreTailwind CSSRedux ToolkitZustandReact QueryOAuth2OpenID ConnectJWTAzure AD

Java Angular Fullstack Developer
Delta Sys-Tech (India) Pvt Ltd Fresher Chennai, BangaloreBangalore, Pune, Mumbai City 23 Sep, 2025

We are Hiring for Java Angular Full Stack Developer
Location:Bangalore, Chennai, Pune & Mumbai hibernatespringjavamicroservicesangularjavascriptfullstack developerjava developer

Senior Data Engineer
ARTECH INFOSYSTEMS PRIVATE LIMITED Fresher Bangalore 23 Sep, 2025

Senior Data Engineer, ED&A ICC Responsibilities:

Design and build reusable components, frameworks and libraries at scale to support analytics products

Desig...
data engineeringsnow flakepythonsqldynamobig dataairflowhivespark

Application Support Engineer
ARTECH INFOSYSTEMS PRIVATE LIMITED Fresher Bangalore 23 Sep, 2025

Job Description As an Application Support Engineer for the Google Cloud Systems Production Support Systems Team, youll provide firont-line technical software support to customer...
application supportsalesforce crmsupport

Infrastructure Security Engineer
WELTEC Institute Fresher Ahmedabad, Gujarat 23 Sep, 2025

As an Infrastructure Security Engineer, you will be responsible for ensuring the security of our infrastructure and protecting against cyber threats. Your expertise in cloud security, vulnerabilit...
awspatch managementsecuritycloudxdrcloud securityedrnacl

Software Developer 3 (Java fullstack)
Oracle Fresher Ahmedabad, Gujarat 23 Sep, 2025

Oracle Health Data Intelligence is seeking a Senior Software Engineer to join the HealtheCare Care Coordination team. In this role, you will write and configure code based on technical specificati...
JavaRubyHadoopMapReduceSparkETLSQLJenkinsKubernetesOCIAWSAzureDevOpsAgile methodologiesCucumberSeleniumCrunchRESTful servicesHadoop Ecosystem

Software Engineer, Networking
SHRI BALAJI ENTERPRISES Fresher Kolkata, Mumbai CityMumbai City, Bangalore, Chennai, Indore, Hyderabad, Pune 20 Sep, 2025

We are seeking aPython Engineerwithstrong experience in AWS cloud servicesto join our engineering team. You will design, develop, and deploy scalable back-end sy...
softwaremaintenancetestingnetworkingmainframedevelopmentapplication

SAP Work Manager Developer
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Kolkata, GurugramGurugram, Mumbai City, Bangalore, Noida, Chennai, Hyderabad, Pune, Delhi 20 Sep, 2025

SAP WorkManager: Primary Skill: SAP Work Manager Delivery Role: Sr. Developer Experience Profile: 06-10 years Candidate should have good knowledge and working experience of SAP Agentry/Work M...
spmmobile developmentjavasap work managerworkdevelopermanager

SAP IBP Consultant
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Kolkata, GurugramGurugram, Mumbai City, Bangalore, Chennai, Noida, Hyderabad, Pune, Delhi 20 Sep, 2025

JOB Description: Key Responsibilities:

Be part of a team that solves problems and provide solutions for large, corporate clients in multiple s...
ibpsap

Fresher Internship Trainee(Live project trainee)
Guidance Placement Hiring For - Fresher Patna, JaipurJaipur, Gwalior, Noida, Kanpur, Gurugram, Delhi, Bhopal, Agra 20 Sep, 2025

Dear Candidate, We are excited to announce urgent openings for both freshers and experienced professionals in various fields. If you are interested in a live project trainee or internship opport...
react.jsandroidphpweb designingangular jslaravelweb developersoftware developersfull stack developer

Junior Full Stack Ruby Developer
Avinyaa Ed Tech Private Limited Fresher Surat, Gujarat 20 Sep, 2025

As a Junior Full Stack Ruby Developer at Avinyaa EdTech, you will be part of an innovative and rapidly growing EdTech company dedicated to revolutionizing the educational experience through cuttin...
RubyRuby on RailsJavaScriptHTML5CSS3RESTful APIsMySQLPostgreSQLMongoDBGitDockerAWSGCPJiraTrelloTDDReactjsVuejsGraphQLAgile development methodologies

Senior WordPress Developer
Tretanz Infotech Fresher Rajkot, Gujarat 20 Sep, 2025

You are an experienced Senior WordPress Developer with a minimum of 3 years of hands-on experience, seeking a full-time, on-site position at Tretanz Infotech in Rajkot. Your main responsibility wi...
PHPHTMLCSSJavaScriptjQueryMySQLGitWordPress developmentBackend web developmentFullstack web developmentObjectOriented Programming OOP

Field Support Specialist 3
Oracle Fresher Delhi 20 Sep, 2025

As a Field Engineer, your primary responsibility will be to provide field system support which includes hardware break-fix, maintenance, and product installation at customer and oracle cloud sites...
MaintenanceTechnical supportHardware breakfixProduct installationService programsSystem level diagnostics

Commis 3
Ghar ka zaika cloud kitchen Fresher Bihar, Patna 20 Sep, 2025

The role of a Commis 3 at Ghar ka zaika cloud kitchen based in Patna is a full-time on-site position that involves various responsibilities. As a Commis 3, you will be primarily tasked with food p...
Effective Communication skillsCulinary SkillsFood PreparationCooking skillsHygiene knowledgeExperience in a professional kitchen environmentAbility to work in a fastpacedhighpressure environmentAttention to detailcreativity in food presentation

Sap Fiori consultant
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Pune, BangaloreBangalore, Mumbai City 20 Sep, 2025

Job Description SAP UI5/ Fiori Grade B2 Min 4 yrs Grade C2 6 yrs Strong knowledge and working experience in UI5 related programming like JavaScript and UI5 libraries. Must be able to extend and...
javascriptsap fiorisap ui5sapsapui5ui5librariessap fiori consultantdeveloper

PREV
NEXT

aws cloud stack Job Openings

Job Title: SAP DRC Consultant

We are Hiring for Java Angular Full Stack Developer

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers