digital creation jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

digital creation Job Openings

Showing 8351 - 8400 of 19080 Jobs

Technical Solutions Architect

eBizneeds 5.00 to 9.00 Years Jaipur,Other Rajasthan 01 Apr, 2025

Solution Architecture

Enterprise Architecture

E commerce Executive jaipur

GT Solusn 0.00 to 2.00 Years Jaipur 01 Apr, 2025

Manage product listings, descriptions,...
online lead generationonline salesonline business optimizationonline marketinglistingsonline business management

Hiring for Field Sales Associate

AASAANJOBS PRIVATE LIMITED 1.00 to 5.00 Years Jaipur,Delhi, Lucknow, Gurugram, Ranchi 01 Apr, 2025

sales marketing

marketing executive

Applications Developer

RAJPUT PROTECTION SERVICE PRIVATE LIMITED 13.00 to 23.00 Years Jaipur,Noida, Delhi, Jaisalmer, Bangalore, Chennai, Hyderabad, Gurugram, Pune, Guwahati 01 Apr, 2025

Job brief We are seeking a qualified and talented Application Developer to join our team. In this role, you will be responsible for designing and coding functional programs and applications. ...
architecture governancevalue engineeringconstruction managementdeveloper/d2kengineeringapplication architecture

Digital Marketing Manager

Lucenta Solutions 1.00 to 3.00 Years Jaipur 01 Apr, 2025

Company Description

social media marketing

seo

Hiring For QA Automation Engineer

Divya Staffing Solution 0.00 to 4.00 Years Indore,Bhopal, Dehradun, Raipur, Surat, Vadodara, Vasco Da Gama, Haridwar, Panaji, Ahmedabad 01 Apr, 2025

computer science

java

sql

Online Sales Marketing Manager

DAYA WORLDWIDE LIMITED 3.00 to 7.00 Years Indore,Other Madhya Pradesh 01 Apr, 2025

Online Sales Management

Prompt Engineer

Codiant - A YASH Technologies Company 12.00 to 16.00 Years Indore,Other Madhya Pradesh 01 Apr, 2025

Machine Learning

Data Science

Natural Language Processing

Analytical Skills

Communication Skills

Social Media and Community Manager

Mitti - Organic Fresh Desi 2.00 to 6.00 Years Indore,Other Madhya Pradesh 01 Apr, 2025

Social Media Management

Content Creation

Community Engagement

Customer Relationship Management

Digital Marketing

Interpersonal Skills

Graphic Design

Online Brand Promotion

Excellent Communication

Knowledge of Indian Cuisine

Knowledge of Organic Food Indus

Windows System Administrator

ESDS Software Solution Limited 5.00 to 9.00 Years Indore,Other Madhya Pradesh 01 Apr, 2025

Performance Optimization

Windows server technology

Virtualizations

Backup

Recovery

Front Desk Manager

Zostel 2.00 to 6.00 Years Indore,Other Madhya Pradesh 01 Apr, 2025

Customer Relationship Management

Compliance Management

Language Skills

City Knowledge

Reservation Management

Business Lead- Digital Marketing

HR THINKER LAB LLP 5.00 to 8.00 Years Indore 01 Apr, 2025

Key Responsibilities:

Business Development & Client Acquisition:

Drive business growth through new client acquisitions for services ...
salessocial marketingseo

Pipeline Engineer

Garima Interprises 1.00 to 6.00 Years Hyderabad,Australia, Austria, Canada, Other AndamanNicobar, Port Blair, Bangalore, Chennai, Noida, U 01 Apr, 2025

Pipeline Engineer Job Description Template We are looking for a highly experienced pipeline engineer to design and develop a variety of pipeline...
budgetingblueprintcommunicationrepairconstruction technologytechnical standards

WALK-IN Drive Java Full Stack Developer(Internship) Hyderabad

GLOBEX DIGITAL SOLUTIONS PRIVATE LIMITED Fresher Hyderabad 01 Apr, 2025

(Without Stipend)

Dates:

java

javascript

microservices

DLP Specilaist

MNR Solutions Pvt Ltd 3.00 to 7.00 Years Hyderabad,Gurugram, Delhi 01 Apr, 2025

DLP

Job Overview:

Data Loss Prevention (DLP) Specialist

qradar

dlp

seim

Applications Developer

RAJPUT PROTECTION SERVICE PRIVATE LIMITED 13.00 to 23.00 Years Hyderabad,Jaipur, Bangalore, Jaisalmer, Noida, Chennai, Gurugram, Pune, Delhi, Guwahati 01 Apr, 2025

Job brief We are seeking a qualified and talented Application Developer to join our team. In this role, you will be responsible for designing and coding functional programs and applications. ...
architecture governancevalue engineeringconstruction managementdeveloper/d2kengineeringapplication architecture

Plant Engineer

RAJPUT PROTECTION SERVICE PRIVATE LIMITED 12.00 to 22.00 Years Hyderabad,Bangalore, Noida, Chennai, Nellore, Gurugram, Kolkata, Pune, Mumbai City, Delhi 01 Apr, 2025

Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla...
project engineeringprocess equipmentengineering processengineeringplant engineering

Automation Testing

Srijan Spectrum Pvt Ltd 8.00 to 13.00 Years Hyderabad,Bangalore, Noida, Chennai, Gurugram, Kolkata, Pune, Mumbai City, Delhi 01 Apr, 2025

ui testinguat

Pipeline Engineer
Garima Interprises 1.00 to 6.00 Years Gurugram,Delhi, Noida, Australia, Austria, Canada, Other AndamanNicobar, Port Blair, Bangalore, Chen 01 Apr, 2025

Pipeline Engineer Job Description Template We are looking for a highly experienced pipeline engineer to design and develop a variety of pipeline...
budgetingblueprintcommunicationrepairconstruction technologytechnical standards

Field Sales Executive
TRAVELMAGNET INFOTECH PRIVATE LIMITED 0.00 to 1.00 Years Gurugram,Delhi, Faridabad, Noida 01 Apr, 2025

About the Role: We are looking for energetic and customer-focused Field Sales Executives to drive merchant acquisition and promote digital payment solutions, specifically EDC (c...
field salessales

Chat Support Executive
JDM CONSULTANCY 1.00 to 5.00 Years Gurugram,Delhi 01 Apr, 2025

Dear Candidate, We have Urgent Hiring for Chat Executive in IGT Solutions : Roles and Responsibilities : _Develop and implement e-commerce st...
chat processnon voicecustomer servicebpoemailemail processchatbackend operations

Video Editor - Advertising Agnecy
MEGMA SERVICES 2.00 to 4.00 Years Gurugram 01 Apr, 2025

ob description

Responsible for managing multiple video projects simultaneously. This includes understanding project requirements, establishing timelines and deadlines....
adobe premiere pro2d animationadobe photoshopmotion graphicsadobe after effectscameravideoadobe illustratortrackingeditor

Hiring for Field Sales Executive in Delhi NCR
AASAANJOBS PRIVATE LIMITED 1.00 to 5.00 Years Gurugram,Delhi 01 Apr, 2025

Meta Job Description Job Title: Sales Consultant Location: Delhi NCR Salary: 25000 CTC (Including Petrol allowance of 2000) Experience: 0-1 year Qualification : Graduate ...
salesfield salessales executive activities

Data Modeler Team Lead/Architect
Angel and Genie 7.00 to 10.00 Years Gurugram 01 Apr, 2025

Data Modeler Architect Position: Data Modeler Architect Experience: 8 years Location: Gurugram Department: IT/Data Architecture Reports to: Data Architecture Lead / Data Manager Position Overvie...
big dataawsdata visualizationgcpazure

Hiring For Online Marketing Executive (Work From Home Or Office Both) DELHI-NCR
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 01 Apr, 2025

Dear Candidate Greetings fromDesnor Destination Pvt Ltd ! Job Summary Idealises Internet Marketing Agency is looking for Marketing Executive to join our dynamic team and embark on a rewarding...
marketing planningdigitaldisplay advertisingmarketingfreelancingwork from homemarketing communicationpart time

Brand Manager
MNR Solutions Pvt Ltd 10.00 to 16.00 Years Gurugram 01 Apr, 2025

Brand Manager Key Responsibilities: Develop and execute comprehensive brand strategies and marketing plans, collaborating with the founders to drive brand growth and strengthen market presence...
brand managementbrand marketingbrand planningbrand campaigns

Applications Developer
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 13.00 to 23.00 Years Gurugram,Delhi, Noida, Jaipur, Bangalore, Jaisalmer, Chennai, Hyderabad, Pune, Guwahati 01 Apr, 2025

Job brief We are seeking a qualified and talented Application Developer to join our team. In this role, you will be responsible for designing and coding functional programs and applications. ...
architecture governancevalue engineeringconstruction managementdeveloper/d2kengineeringapplication architecture

Plant Engineer
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 12.00 to 22.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Nellore, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

We are looking for a Plant Manager to drive continuous improvement and optimization of all processes.
Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla...
project engineeringprocess equipmentengineering processengineeringplant engineering

NTT DATA Virtual Drive Hedge Fund Gurgaon
NTT DATA INFORMATION PROCESSING SERVICES PRIVATE LIMITED 1.00 to 3.00 Years Gurugram 01 Apr, 2025

NTT DATA is Hiring experienced candidates for Hedge Fund Accounting domain. Location:Gurgaon Sector 48 (Candor Techspace) Work from Office Only Shift ...
reconciliationhedge fundsnav calculationinvestment banking

Design Verification Engineer
GLOBEX DIGITAL SOLUTIONS PRIVATE LIMITED 6.00 to 11.00 Years Kochi,Bangalore, Chennai, Noida, Hyderabad, Gurugram, Pune, Mumbai City, Delhi, Ahmedabad 01 Apr, 2025

Greeting form Globex Digital.! Please find the job description for _Design Verification Engineer interested please revert back with updated resume. JD: Design Verification Engineer Experience:...
uvmsystem verilogdesign verificationsub systems

Junior IoT Hardware and Firsm ware Developer @Amritapuri
Amrita Vishwa Vidyapeetham 2.00 to 6.00 Years Kollam,Other Kerala 01 Apr, 2025

Job Title Junior IoT Hardware And Firsm ware Developer Required Number 1 Qualification B.Tech, Good to have M.Tech but not a must to have requirement Job Description Tranquility IoT & Big Data Sol...
Electronics design skillsknowledgeKnowhow of embedded codingAbility to think out of the box

E2E CNX Architect / CNX Solution Architect
Infosys Limited 4.00 to 8.00 Years Other Kerala,Thiruvananthapuram 01 Apr, 2025

Key Responsibilities: A day in the life of an Infoscion As part of the Infosys consulting team your primary role would be to lead the engagement effort of providing high quality and value adding...
AWSDevOpsGoogle Cloud PlatformKubernetesTelecomSDLCAgile MethodologiesProject ManagementTeam ManagementAgile CoachBusiness Analyst

Creative Strategist
Samagra Progressive Learning Solutions Pvt Ltd 2.00 to 6.00 Years Kochi,Other Kerala 01 Apr, 2025

Samagra Progressive Learning Solutions Private Ltd is the brainchild of Madhu Bhaskaran, a renowned Business Strategist and HRD trainer. We aim to create a sense of total revamping in the lives of...
Market ResearchContent CreationCommunity EngagementCampaign ManagementBrand AwarenessLead GenerationVideo ProductionSocial Media StrategySocial Media Analytics

Sr DOTNET Developer (MVC)
TPHRC PVT LTD 7.00 to 11.00 Years Other Kerala,Thiruvananthapuram 01 Apr, 2025

Experience: 7-8 Years Minimum Location: Trivandrum Mode Of work: On Site Responsibilities: Build and maintain application functionality for new and existing systems using the .Net toolset with...
Entity FrameworkSQL ServerHTMLCSSJavaScriptjQueryMVC FrameworkWeb servicesXMLASPNETASPNET CoreEntity Framework CoreREST Web APIs

Creative Content Creator & Presenter
Royal Trading Co (Utsav) 2.00 to 6.00 Years Kochi,Other Kerala 01 Apr, 2025

We are looking for a female Content Creator & Presenter to develop, present, and publish engaging video content across social media platforms. The ideal candidate should have a strong on-camera ...
Content CreationVideo EditingSocial MediaCreativityStorytelling

Graphic Design & Multimedia Trainer
IFDA Institute 1.00 to 2.00 Years Delhi 01 Apr, 2025

Job Summary:
We are seeking a passionate and skilled Graphic Design & Multimedia Trainer to train students in industry-standard design, animation, and...
corel drawautodesk maya3ds maxvideo editingafter effectsindesigngraphic designersautocadphotoshop

ICICI Bank Aspire Program
ICICI Bank Ltd 0.00 to 1.00 Years Delhi,Noida, Bangalore, Chennai, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City 01 Apr, 2025

About the Company ICICI Bank Ltd, is one of Indias leading private bank offering a wide range of financial services. Established in 1994, it is headquartered in Mumbai and has ...
salesrelationship managementmanagement

DLP Specilaist
MNR Solutions Pvt Ltd 3.00 to 7.00 Years Delhi,Hyderabad, Gurugram 01 Apr, 2025

DLP Location-Pan India Grade-P2/P3/P4 NP-30 days Job Overview: We are seeking a skilled Data Loss Prevention (DLP) Specialist to join our I...
qradardlpseim

Plant Engineer
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 12.00 to 22.00 Years Delhi,Noida, Bangalore, Chennai, Nellore, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City 01 Apr, 2025

We are looking for a Plant Manager to drive continuous improvement and optimization of all processes.
Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla...
project engineeringprocess equipmentengineering processengineeringplant engineering

WordPress Web Designer
TripleDStudio 2.00 to 6.00 Years Chandigarh 01 Apr, 2025

Company Description TripleDStudio is a renowned brand in the fields of web design, development, digital marketing, and online advertisement. Founded in November 2016, the company has quickly esta...
Web DesignResponsive Web DesignGraphic DesignWordPressFrontEnd Development

Quality Assurance Analyst
Emerson 1.00 to 5.00 Years Chandigarh 01 Apr, 2025

Job Description Job Summary The Quality Assurance Analyst will test web-based applications and API used by our employees and customers. They will provide support to end-users in the organization...
Quality AssuranceTestingAPISoftware ApplicationsTest CasesSystem IntegrationRegression TestingPerformance TestingCustomer ServiceBug TrackingMicrosoft TechnologiesCommunication SkillsOrganization SkillsInterpersonal SkillsAgile ScrumSQLAut

Digital Marketing Intern
Momade Miracles 0.00 to 4.00 Years Panchkula,Other Haryana 01 Apr, 2025

Market research: Collecting data to identify target audiences, new markets, and campaign success Content creation: Writing marketing materials like blog posts, social media posts, press releases,...
Market researchContent creationCampaign executionSocial media

Territory Sales Executive
Manu Varghese Digital 13.00 to 17.00 Years Chandigarh 01 Apr, 2025

Summary We are looking for a highly motivated Territory Sales Executive to take charge of our regional sales operations. This is a fantastic opportunity to lead our territory expansion, build a s...
B2B salescommunicationnegotiationmarketing strategies

Marketing coordinator
M/S AASTHA LIFECARE CORPORATION PRIVATE LIMITED 13.00 to 23.00 Years Chandigarh,Baloda Bazar, Papum Pare, Begusarai, Kokrajhar, Kamrup Metropolitan, Vishakhapatnam, Siwa 01 Apr, 2025

A Marketing Coordinator supports the marketing team by developing, coordinating, and executing marketing campaigns, while also assisting with market research, content creation, and data analysis ...
serviceresearchpubliccustomerdigitalmarketingmanagementsalesmarketstrategycoordinatorevent

Journalist
ThroughBit 0.00 to 3.00 Years Coimbatore,Other Tamil Nadu 01 Apr, 2025

Education - Bachelors degree in Journalism, Communications, or a related field. Experience 0 2 Years Key Responsibilities: Gather real-time information from industry experts, events, and exte...
JournalismMass CommunicationCryptocurrencyWritingEditingVerbal CommunicationNews ReportingStorytellingInterpersonal SkillsNetworkingWeb3Blockchain TechnologyDecentralised Applications

SAP MM WM Consultant
NTT DATA Services 7.00 to 11.00 Years Coimbatore,Other Tamil Nadu 01 Apr, 2025

Req ID: 315693 NTT DATA strives to hire exceptional, innovative and passionate individuals who want to grow with us. If you want to be part of an inclusive, adaptable, and forward-thinking organi...
SAP MMSAP WMWarehouse ManagementIntegrationProject ManagementIDOCSAP S4HANAEnd to End ImplementationSTO ProcessesInbound ProcessesOutbound ProcessesPhysical Inventory CountCross DockingReplenishment ProcessHandling Unit ManagementMobile Dat

Sales and Marketing Coordinator
Goat Robotics 2.00 to 6.00 Years Coimbatore,Other Tamil Nadu 01 Apr, 2025

Job Title: Sales and Marketing Coordinator Job Summary: Key Responsibilities: Handle Request for Quotations (RFQs) from clients, ensuring accurate and timely submissions. Track and manage the ...
order processingMS Officecommunicationinterpersonal skillsB2B salesindustrial salesERPdigital marketinglead generationRFQ handlingsales pipeline managementCRM toolsorganizational skillsmultitasking

Pipeline Engineer
Garima Interprises 1.00 to 6.00 Years Chennai,Australia, Austria, Canada, Other AndamanNicobar, Port Blair, Bangalore, Noida, United Arab 01 Apr, 2025

Pipeline Engineer Job Description Template We are looking for a highly experienced pipeline engineer to design and develop a variety of pipeline...
budgetingblueprintcommunicationrepairconstruction technologytechnical standards

Applications Developer
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 13.00 to 23.00 Years Chennai,Jaipur, Bangalore, Jaisalmer, Noida, Hyderabad, Gurugram, Pune, Delhi, Guwahati 01 Apr, 2025

Job brief We are seeking a qualified and talented Application Developer to join our team. In this role, you will be responsible for designing and coding functional programs and applications. ...
architecture governancevalue engineeringconstruction managementdeveloper/d2kengineeringapplication architecture

Plant Engineer
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 12.00 to 22.00 Years Chennai,Nellore, Bangalore, Noida, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City, Delhi 01 Apr, 2025

We are looking for a Plant Manager to drive continuous improvement and optimization of all processes.
Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla...
project engineeringprocess equipmentengineering processengineeringplant engineering

PREV
NEXT

digital creation Job Openings

Pipeline Engineer Job Description Template We are looking for a highly experienced pipeline engineer to design and develop a variety of pipeline... budgetingblueprintcommunicationrepairconstruction technologytechnical standards

Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla... project engineeringprocess equipmentengineering processengineeringplant engineering

Pipeline Engineer Job Description Template We are looking for a highly experienced pipeline engineer to design and develop a variety of pipeline... budgetingblueprintcommunicationrepairconstruction technologytechnical standards

Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla... project engineeringprocess equipmentengineering processengineeringplant engineering

Job Summary:

Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla... project engineeringprocess equipmentengineering processengineeringplant engineering

Pipeline Engineer Job Description Template We are looking for a highly experienced pipeline engineer to design and develop a variety of pipeline... budgetingblueprintcommunicationrepairconstruction technologytechnical standards

Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla... project engineeringprocess equipmentengineering processengineeringplant engineering

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Pipeline Engineer Job Description Template We are looking for a highly experienced pipeline engineer to design and develop a variety of pipeline...
budgetingblueprintcommunicationrepairconstruction technologytechnical standards

Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla...
project engineeringprocess equipmentengineering processengineeringplant engineering

Pipeline Engineer Job Description Template We are looking for a highly experienced pipeline engineer to design and develop a variety of pipeline...
budgetingblueprintcommunicationrepairconstruction technologytechnical standards

Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla...
project engineeringprocess equipmentengineering processengineeringplant engineering

Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla...
project engineeringprocess equipmentengineering processengineeringplant engineering

Pipeline Engineer Job Description Template We are looking for a highly experienced pipeline engineer to design and develop a variety of pipeline...
budgetingblueprintcommunicationrepairconstruction technologytechnical standards

Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla...
project engineeringprocess equipmentengineering processengineeringplant engineering