education on product features jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

education on product features Job Openings

Showing 21551 - 21600 of 58049 Jobs

Unit Sales Manager

ICICI LOMBARD GENERAL INSURANCE CO LTD 1.00 to 2.00 Years Indore,Nashik, South Goa, Ahmednagar, North Goa, Pune, Nagpur, Other Goa 01 Apr, 2025

Sales Team Coach

ICICI LOMBARD GENERAL INSURANCE CO LTD 3.00 to 8.00 Years Indore 01 Apr, 2025

sales operationsleadership skillsoutbound salesteam handlingtelesalescall center operationstarget achievementverbal communicationsales support

Urgent hiring for Mechanical Engineer Fresher

Jobhunt Consultants Fresher Hyderabad,Noida, Delhi 01 Apr, 2025

service engineering

production engineering

Area Sales Manager

Transformatrix Global Private Limited 6.00 to 11.00 Years Hyderabad 01 Apr, 2025

Data Entry Executive Work For Freshers,Part time work

VRD INFOTECH 0.00 to 1.00 Years Hyderabad,Bangalore, Chennai, Noida, Gurugram, Kolkata, Pune, Mumbai City, Delhi, Bhopal 01 Apr, 2025

excel

typing

data entry

Process Associate

STRYDE CONSULTING SERVICES Fresher Hyderabad 01 Apr, 2025

icse

excellent communication

Regional Sales Manager-Project sales( construction chemicals)

MEGMA SERVICES 12.00 to 20.00 Years Hyderabad,Bangalore, Chennai 01 Apr, 2025

Global construction chemical brand requires Regional sales Mgr ( Project sales)- Bangalore /Chennai/Hyderabad One of our client aGlobal construction chemical MNC aa 100% subsidiary o...
project sales headconstruction chemical sales

Mechanical Engineer
ATOVITT SERVICES PRIVATE LIMITED 4.00 to 9.00 Years Hyderabad,Ethiopia, Bangladesh, Anantpur, Bangalore, Noida, Chennai, Kolkata, Gurugram, Pune, Mumbai 01 Apr, 2025

We are looking for a creative Mechanical Engineer to work on all product stages from research and development to design and manufacture, through to installation and final commissioning.The goal i...
thermodynamicsoptimizationfluid mechanicstroubleshootingmachine designadaptabilitystructural analysisquality assurancematerial science

Quality Engineer
AES INDUSTRIAL PRIVATE LIMITED 15.00 to 23.00 Years Hyderabad,China, Iran, Other Haryana, Other Bihar, South Korea, Other Assam, Iraq, Bangalore, Philip 01 Apr, 2025

Job brief
Were currently seeking a highly skilled and experienced Quality Engineer to join our team. In this role, you will be responsible for ensuring the safety and quality of our prod...
goodqualityanalyticalsupplier qualityengineering change managementquality managementengineer

Urgent Opening for Frontline Sales Associate for Insurance Domain
SPECTRUM INSURANCE BROKING PRIVATE LIMITED 1.00 to 3.00 Years Hyderabad,Bangalore, Mohali, Chennai, Kolkata, Gurugram, Pune, Mumbai City, Itanagar, Other Arunacha 01 Apr, 2025

As a Front Line Sales (FLS) employee in Agency channel, you will leverage your network to recruit Financial Consultant (Agents) and coach them to sell life insurance policies and service customer...
direct salesb2b salesb2c salesinsurance salesclient servicinglife insurancebfsi saleslead generation

We are hiring for Frontline Sales Associate for Insurance Domain
SPECTRUM INSURANCE BROKING PRIVATE LIMITED 0.00 to 3.00 Years Hyderabad,Bangalore, Srikakulam, Ongole, Chennai, Vizianagaram, Guntakal, Kolkata, Mumbai City, Anan 01 Apr, 2025

Are you good at networking and training teams If yes, then this is the right job for you! As a Front Line Sales (FLS) employee in Agency channel, you will leverage your network to recruit Finan...
life insurancesalesclient servicinglead generationbfsi salesb2b salesinsurance salesb2c sales

WALK-IN Drive Java Full Stack Developer(Internship) Hyderabad
GLOBEX DIGITAL SOLUTIONS PRIVATE LIMITED Fresher Hyderabad 01 Apr, 2025

Warm Greeting for the Day! WALK-IN Drive for Java Full Stack Developer Internship Program(Without Stipend) which for Hyderabad Location. Dates:1-April-2025 to ...
javajavascriptmicroservices

Account Management Director
SPENTO PAPERS (INDIA) LLP 12.00 to 22.00 Years Hyderabad,Bangalore, Noida, Chennai, Gurugram, Kolkata, Pune, Tadepalligudem, Mumbai City, Delhi 01 Apr, 2025

We are seeking an experienced Account Management Director to lead and optimize our Account Management team. This leadership role will focus on driving customer success and revenue growth, ensuri...
medicaresalesservicemedicaidcustomerbusinessdevelopmentoversightprocessimprovement

Workforce Management Consultant
DIGITALCUBE CONSULTANCY SERVICES PRIVATE LIMITED 8.00 to 10.00 Years Hyderabad,Bangalore, Noida, Chennai, Gurugram, Kolkata, Pune, Mumbai City, Delhi 01 Apr, 2025

Designation: Workforce Management Consultant Experience Required: 8 years Work Mode: WFH Key Responsibilities: kronos timekeepingkronos wfcwfmsap hrpro

Head Chef (Industrial Canteen)
MALABAR GOLD LIMITED 5.00 to 10.00 Years Hyderabad,Other Telangana 01 Apr, 2025

Greeting from Malabar!
Job Title : Head Chef ( Industrail Canteen) Experience : 6 years experience Location:Maheshwaram, Telanagana Department<...
kitchen managementmenu planninginventory managementhygienist activitiesindustrial

DLP Specilaist
MNR Solutions Pvt Ltd 3.00 to 7.00 Years Hyderabad,Gurugram, Delhi 01 Apr, 2025

DLP Location-Pan India Grade-P2/P3/P4 NP-30 days Job Overview: We are seeking a skilled Data Loss Prevention (DLP) Specialist to join our I...
qradardlpseim

Pre Sales Executive
DIGITALCUBE CONSULTANCY SERVICES PRIVATE LIMITED 1.00 to 3.00 Years Hyderabad,Delhi 01 Apr, 2025

Designation:Pre-Sales Executive Experience Required:6month to 2years Location: presalestele sales

Applications Developer
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 13.00 to 23.00 Years Hyderabad,Jaipur, Bangalore, Jaisalmer, Noida, Chennai, Gurugram, Pune, Delhi, Guwahati 01 Apr, 2025

Job brief We are seeking a qualified and talented Application Developer to join our team. In this role, you will be responsible for designing and coding functional programs and applications. ...
architecture governancevalue engineeringconstruction managementdeveloper/d2kengineeringapplication architecture

Plant Engineer
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 12.00 to 22.00 Years Hyderabad,Bangalore, Noida, Chennai, Nellore, Gurugram, Kolkata, Pune, Mumbai City, Delhi 01 Apr, 2025

We are looking for a Plant Manager to drive continuous improvement and optimization of all processes.
Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla...
project engineeringprocess equipmentengineering processengineeringplant engineering

Full Stack Developer
LTIMindtree Limited 6.00 to 10.00 Years Hyderabad,Noida 01 Apr, 2025

Job Description Develop maintain enhance and test client systems of moderate to high complexity Execute full software development life cycle SDLC build highquality innovative and performing sof...
sdlcjavaaws

Customer Care Representative
Hucon Solutions India PvtLtd 1.00 to 5.00 Years Hyderabad 01 Apr, 2025

GREETING FROM HUCON SOLUTIONS Hiring for MNCs Process: International Voice Process Job Details:International Voice Process Location:Hyderabad Eligibility Criteria Minimum 8 months to 3 yea...
semi voice processcustomer servicevoice process

Business Development Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 8.00 to 12.00 Years Hyderabad,Bangalore, Noida, Chennai, Gurugram, Pune, Mumbai City, Delhi 01 Apr, 2025

Key Responsibilities:

Strategic Planning: Develop and execute strategic business development plans that align with company goals and target ma...
sales growthanalysismarket analysisadaptabilityadministration workmarketcommunicationstrategic planningstrategic thinkinginnovationnegotiationcontractsresearch

Customer Care Executive
Conneqt Business Solutions Limited 0.00 to 2.00 Years Hyderabad 01 Apr, 2025

Process: Axis Bank Inbound Voice (Customer Support) Qualification: Intermediate & Above Salary: Freshers: 14000 TH (NAPS) Languages: English & Hindi 6 Days Working 1 rotati...
communication skillsflexible

RELIANCE LIFE INSURANCE - SPOT OFFER - ON ROLE - HIGH CTC - PAN INDIA
RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 1.00 to 6.00 Years Hyderabad,Bangalore, Chennai, Noida, Gurugram, Kolkata, Pune, Mumbai City, Delhi 01 Apr, 2025

Job Role : Senior Relationship Manager, Greetings! Roles & Responsibilities,

Candidate has to work on the leads provided by the Organization.

Cand...
life insuranceagent recruitment

Agency Development Manager
RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 0.00 to 4.00 Years Hyderabad 01 Apr, 2025

We are pleased to offer you the chance to advance your career with one of Indias top three most trusted life insurance brands, as recognized in the Brand Equity Most Trusted Brands Survey 2018. W...
insurance agency managementchannel partnersdirect salesagency sales

Exciting Data Entry Executive Role Work from Home Opportunity
Pick Bright HR Solution 0.00 to 1.00 Years Gwalior,Bangalore, Chennai, Bidar, Udupi, Thane, Thrissur, Yavatmal, Surat, Chatra 01 Apr, 2025

Dear candidate, We are excited to announce immediate openings for Part-Time Data Entry Operator roles with our company, available for candidates across India. skills needed: basic computer know...
english writingdata entry

Requirement in Agency Development manager for Life Insurance CTc upto 5.5 lacs
ATS Infovision 3.00 to 8.00 Years Gwalior,Bhopal, Jabalpur, Solapur, Rajkot, Pune, Aurangabad, Surat, Nagpur 01 Apr, 2025

Dear Candidates, Greetings of the day! Candidate Qualifications:

Previous Sales Experience: Proven success in a sales role, prefe...
agency developmentagent recruitmentunit manager

Assistant Teacher in DAV
RENOVISION TECHNOLOGY 0.00 to 1.00 Years Gwalior,Indore, Bhopal, Nashik, Bhubaneswar, Cuttack, Rourkela, Fatehgarh Sahib, Ferozpur, Hoshiarpu 01 Apr, 2025

We are seeking an experienced and dedicated preschool teacher to join our team. The successful candidate will be responsible for creating a safe and nurturing learning environment fo...
educational consultingteacher trainingeducation reformteacher mentoringteacher evaluation

Product Manager
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 15.00 to 25.00 Years Gwalior,Indore, Bhopal, Jabalpur, Ratlam, Sagar, Ernakulam, Pala, Wayanad, Thiruvananthapuram 01 Apr, 2025

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c...
product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing

Profiles to be source-Agency Direct - in Life Insurance
ATS Infovision 2.00 to 7.00 Years Gurugram,Dehradun 01 Apr, 2025

Dear Candidates Greetings of the Day, We are the leading Job Consultancy for BFSI Sector and have tieup with almost all major life Insurance companies for recruitment...
life insurancebusiness developmentagency developmentagency channelassociate development

Ppc Head. .
Institute of Selection 10.00 to 12.00 Years Gurugram,Delhi 01 Apr, 2025

Job Title: PPC Head Woven Fabrics Location: Gurugram Experience: 10 Years Industry: Textile / Woven Fabrics Manufacturing Salary: Negotiable Job Overview: we are a recruitment consultancy W...
ppcplanningproductionwoovenfabrics

Academic Counsellor
Ksirius Consultants Hiring For Aimlay and IIDE 1.00 to 4.00 Years Gurugram,Delhi, Noida, Ambernath, Thane, Mumbai City, Dombivali 01 Apr, 2025

Responsibilities: Contact prospective customers through inbound leads follow up on calls and emails (leads are provided). Converting the leads via Outbound calls Explaining the services and conve...
outbound salesacademic consultinginside salescounsellor

Cluster Head - ADRV Insurance Team Handling Profile Salary Upto 14Lac
Niyukti Management Consultants 10.00 to 17.00 Years Gurugram,Delhi, Noida, Lucknow, Pune, Mumbai City 01 Apr, 2025

We are currently hiring for a key position and would like to share the updated requirements with you. Kindly review the details below: Key Specifications:
insurance agency managementinsurance saleslocation headterritory managerbranch headbranch managerchief branch managerarea manager

Senior Quality Engineer
Xperts Manpower Solutions Enterprises Hiring For MNC Automotive Company 0.00 to 2.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida, Manesar, Kundli 01 Apr, 2025

Dear All candidates. We are hiring for Mnc Tier1 Automotive and Automobile manufacturers for Delhi Ncr locations. we are specialised and well experienced in Hiring for btech Mechanical Engineer...
mechanical engineeringaudit documentationproduction planning controlnew product developmentproduction engineeringquality controlthermoformingproduction scheduling

Sr.Finance Manager
Confidential 10.00 to 15.00 Years Gurugram 01 Apr, 2025

We are Hiring for Senior Finance Manager - SahiBandhu FinTech Services ( The Manipal Group) About Us:- SahiBandhu is Indias leading gold loan platform backed b...
gaapbenefits realisationcash flowrisk managementfinancial analysiserpfinancial reportingstakeholder managementerp software

Sr. Electrical Design Engineer
JustHR 8.00 to 13.00 Years Gurugram 01 Apr, 2025

Role: Electrical Engineer Location: Gurgaon, India Profession/Role type: Engineering/Individual Contributor Employment type: Full-Time About us Wearecreating a platform for passionate engineer...
powerautocadbuildingdistributiondesignetapengineerelectrical

Sr. Managing Partner APC Life Insurance Company salary upto 7Lac
Niyukti Management Consultants 6.00 to 11.00 Years Gurugram,Delhi, Faridabad, Noida, Karnal, Sirsa, Dehradun, Jaipur, Indore, Bhopal 01 Apr, 2025

Job Opening: Sr. Managing Partner APC Life Insurance Company Location: Delhi, Gurugram, Noida, Faridaba...
life insurancesalesunit managerbusiness development managerdeputy branch manager sourcingdevelopment managersales manageragency development managerbusiness manager

Urgent | Hiring for Admission Head for Corporate Pre school at Gurugram
HR Globe Recruitment Service 3.00 to 8.00 Years Gurugram 01 Apr, 2025

Dear Candidates, Urgent | Hiring for Admission Head for Corporate Pre school at Gurugram Salary upto 55k Interested candidates please call hr on hidden_mobile 1. Me...
parent communicationcounsellinglead generationpreschoolonline lead generation

Video Editor - Advertising Agnecy
MEGMA SERVICES 2.00 to 4.00 Years Gurugram 01 Apr, 2025

ob description

Responsible for managing multiple video projects simultaneously. This includes understanding project requirements, establishing timelines and deadlines....
adobe premiere pro2d animationadobe photoshopmotion graphicsadobe after effectscameravideoadobe illustratortrackingeditor

Data Entry Executive Work For Freshers,Part time work
VRD INFOTECH 0.00 to 1.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Bhopal 01 Apr, 2025

Dear Job applicant, It is one of the easiest part-time online jobs for candidates Position: Fresher /Computer Operator/ Data Entry Operator / backed office executive skills needed: basic compu...
exceltypingdata entry

Sr HRBP Associate -Gurugram
MEGMA SERVICES 3.00 to 6.00 Years Gurugram 01 Apr, 2025

Leading engineering and construction company requires Sr HRBP Associate - Gurugram One of our client luxury brand which is Indias leading manufacturer of premium doors, windows, wood house and t...
hr operationshrbpassociate

Hvac Design Engineer
JustHR 14.00 to 20.00 Years Gurugram 01 Apr, 2025

Role: Lead/Principal Mechanical Engineer - HVAC Design Location: Gurgaon, India Profession/Role type: Engineering/Individual Contributor Employment type: Full-Time About us We arecreating a p...
designplumbingmepbimhvacrevitsystem

E-commerce Account Managment Lead - CBT (Cross Border Trade)
ACUITTY CONSULTANTS LLP Hiring For AcuittyTech 1.00 to 2.00 Years Gurugram 01 Apr, 2025

Key Responsibilities: As an e-commerce account manager, you will work with one of the worlds largest companies to guide their partners ( business-to-businesskey account managementaccountabilitycommunication skillsexport import documentationrelationship buildingms excele-commerce account managementproduct listing

Urgent Hiring For the Position of Relationship Manager and Sales Officer
DREAMS SOLUTIONS 1.00 to 6.00 Years Gurugram,Delhi, Faridabad, Noida 01 Apr, 2025

Dear Candidates Greeting For a day ! We have job opening in Banking Sector for the profile of # Relationship Manager personal loanscasa sales

Data Modeler Team Lead/Architect
Angel and Genie 7.00 to 10.00 Years Gurugram 01 Apr, 2025

Data Modeler Architect Position: Data Modeler Architect Experience: 8 years Location: Gurugram Department: IT/Data Architecture Reports to: Data Architecture Lead / Data Manager Position Overvie...
big dataawsdata visualizationgcpazure

Linux Engineer
Angel and Genie 4.00 to 8.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

Linux (Plesk) Engineers role with us is a strategic bridge between development and IT operations, taking on operational tasks to ensure the efficient functioning of complete infrastructure and it...
linuxhatplesk

Hiring For Online Marketing Executive (Work From Home Or Office Both) DELHI-NCR
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 01 Apr, 2025

Dear Candidate Greetings fromDesnor Destination Pvt Ltd ! Job Summary Idealises Internet Marketing Agency is looking for Marketing Executive to join our dynamic team and embark on a rewarding...
marketing planningdigitaldisplay advertisingmarketingfreelancingwork from homemarketing communicationpart time

Phone Banking Officer
EBIXCASH GLOBAL SERVICES PRIVATE LIMITED 0.00 to 1.00 Years Noida 01 Apr, 2025

Payroll Company Name : - Ebixcash Global Services. www.ebixcashglobalservices.com Were hiring Male / Female Fresher and experienced candidates for Ebixcash Process ( Customer ...
tamil speakingtelugukannadatele sales excecutive

Full Stack Developer
LTIMindtree Limited 6.00 to 10.00 Years Noida,Hyderabad 01 Apr, 2025

Job Description Develop maintain enhance and test client systems of moderate to high complexity Execute full software development life cycle SDLC build highquality innovative and performing sof...
sdlcjavaaws

Python API -Developer
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 2.00 to 6.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

Represent API Support with project teams to ensure that API knowledge is provided, thus ensuring effective support for new products and enhancements

Grow an up-to-date knowledg...
data visualizationgitlanguagecssapplication developmentpythonjavascriptchange managementdata structureshyperanalyticshtmlmarkup

PREV
NEXT

education on product features Job Openings

Job brief

Were currently seeking a highly skilled and experienced Quality Engineer to join our team. In this role, you will be responsible for ensuring the safety and quality of our prod... goodqualityanalyticalsupplier qualityengineering change managementquality managementengineer

Greeting from Malabar!

Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla... project engineeringprocess equipmentengineering processengineeringplant engineering

Key Responsibilities:

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c... product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Were currently seeking a highly skilled and experienced Quality Engineer to join our team. In this role, you will be responsible for ensuring the safety and quality of our prod...
goodqualityanalyticalsupplier qualityengineering change managementquality managementengineer

Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla...
project engineeringprocess equipmentengineering processengineeringplant engineering

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c...
product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing